TCONS_00000101 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000101
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5561

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000101 ID=TCONS_00000101|Name=|organism=Clytia hemisphaerica|type=transcript|length=5561bp
TCTCATTCCTGAAAGAAGAGAGGGTAAAAATCTGGTGTGGTTGACTTTTT
TGAGCAGTTGACCTTTTTATTTCGATGCAGGAGTGGGATGTTTATGTTTC
AGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGA
TTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAG
ATATCATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTT
ATAAAGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGAAAC
TCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCATAA
CATCAACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAA
CCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGG
AAGAAGCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtcatga
aaGGACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGACAGAA
AATGAAGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATTCATC
AGGGTATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGATGGCA
CGACCACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACGCACG
AAAGGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTC
ATCAAATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgTTACT
CCGATTACGATTACGACGTTCGCTCCATTACCGACGACACTGACGATTAC
GCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAACCCGA
GCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTATCA
TTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGCCAGT
GAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTGAAGG
TTTGAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCAT
TGAAAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGACTTG
GAGCAACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGAACAC
ACCCAACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTGGAAC
GAGCACGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaa
gaaagaaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGAT
TGACATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGACAG
AACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGACATG
ATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAACCAA
AGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCACATTG
AAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGAACTT
GAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAGAA
AGTATCTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATCGCTG
ACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTACAGAT
CTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACGGTGG
CACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTTATAA
ATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGAACTT
GAACtggaaaatgataattatttaaaagaaattaaagGCGTTTATGATAA
TTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATAAAGG
ATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgcgGAA
AAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAGAGAA
ACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCGCAGT
ATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCATT
GCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACGATTC
TGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTTAT
CGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAATTTG
GAACGAAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTC
CATGGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACG
CATTAGAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTATCC
CTTGAAAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAA
TACACACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATTCGT
GTACGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGG
GAAGCATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGTGAC
GTCGAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGACAAAT
TGAAGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAA
GTGAAAATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaa
actcaaaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTAGAAC
GTTCGAAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACACGAAC
AAGGACTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaatata
CACAGAATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGC
GGTCTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaatta
atagaaaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaagattc
ACAAATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCA
CGTCCTTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTCGATG
GTAATGGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGT
TCGCCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGACTCTT
TACAAGAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAAAGAC
ACGATTTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAAATAA
GGATCAAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACATAAAA
TTCGTATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGTAACA
GCGAGCCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAAT
TTATCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCT
ATTTAGCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGACA
GGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAAGCCC
TCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCCGCCA
TTTTGGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATCAAAC
ATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCATA
TATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGATC
GTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGATATG
TATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATGCC
TCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGTCG
CTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGACGAC
TCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCTTC
GCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATCAA
ATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATCAACG
AGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGCTGGA
TGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACATG
AGAAATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAGGG
TTAGAACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATTCG
AAACACTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACTGGGT
CCTTCGATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACACCATC
ATATCGCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTAATGT
GAACGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAACAT
CCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATGTT
CCAGATAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATCAAC
GTCACAAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTT
CGGCCAACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTT
CGTCGACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAATAT
TGGGTCATGAGACACAAAACAAACTGACTAAAGTCTTTGAGAAAgagatt
tctaaaaagaaaatctttcggTCTTCGGCAACCAGGCATGGattttcttg
actttttaaaaagatgatatatttattttggtatttttgtttgTATGGCA
GCTTCACACTaacccagacggcacacaacgtcaaaacaacgtccatttga
cattcatagcGTCCAAATGACggtatttgaacgttaaaagaacgttgtgt
gccagctgggaagcgTCGTTTTAGTTCGCTCATTCGAATATTATATTGGT
GTTATGGACATTAGATGAATGTACAATTGACTCTCGCTTATGCGAACTCA
AAAGGCAAAGCTGGATTGTTCGAATCATTAGGCGCCTTCTTGACATAAAT
ATAGCCGCCACCCGGCGTCGCAGCCGCTGAGTAGAGTGGTGACAAACCTG
CATGCCAAAGCCCTTATGATAGTTGAGTGGATCTAGATGTCGTtgattta
gttcgaattagcgtGGGTTCGCTGTAGCTTTGAAGTTTTGTGCCAGATGA
GGCTGGGATACACCGAGTTTcgttttaaacgaaaatatattaatttctta
tttcttaATGA
Run BLAST on NCBI

protein sequence of TCONS_00000101-protein

>TCONS_00000101-protein ID=TCONS_00000101-protein|Name=TCONS_00000101-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1618bp
MAQENDESFVKDICRDFIPQKWRKTKCQTCFKDIIEHTKGLTHEESETFI
KQCMDETDNDDDCFETQTEETFRKISRGRNIITSTSTIVAENEQPCFQEP
HCHQHHHQRRRQFSQGRSSKENSLDVDVNDVMKGRPVDSENEADDPLTEN
EGMNTPLLTRRKRHSSGYPFEHMDSHENTEDGTTTPNRISSKSRSRSRTK
GKSQSNLLSLSAMMLSSNSSLCSYTSELTDGYSDYDYDVRSITDDTDDYA
DIPDVVIEELELIKPELKARVENERRVSRSRIISLERELEGQHDYHRASE
VARDRQLKSLQRDIEGLKLELSSVKAHENILALKSRLELEGKNSRIHDLE
QQNQTLKEEIQDITNTPNTNEAQQELLIKELERARKWIDKLEEENRAVEE
RKRLAEDLQKNDKELIDILRNQCGSLEEDLTTEQDRNSQLEDKLKLLDMM
RSDFLKEQEKHVKTTKELESMRQKIKRRDRHIEDLEDDNVKLQQLKQELE
SNMAKKEFKIKKVEKKVSVLQHEVIHCNKQIADLTGENKTLEQVKRLTDL
KLKDMSSIAQQSGNGGTNSGTTEVATNEQFFINTLEDRLKHRESRLKELE
LENDNYLKEIKGVYDNLLDVERQREECKEQIKDNEIRLSKLRKENKNAEK
KIELLHRKLQKSEKEKRRALNKQTQAEMKLSQYHQEQESVAMALSAARIA
ENTADQQATYDSSDDSDSRILKLKLQSTEARLSMIEVNKGYLESKVINLE
RKLMDKEQEILRLNDSMERDSGAPSQDYDRFDALERENIMLQTKLDELSL
ENAEQKDMVNKLKEGNTHLEKTIQNLNTKLDSCTFRLKELEEANHKLGRE
ALKRNESISCAHDEVTSSLNELKEHNKTLQDKLKHFENVEDLVEQLEQQV
KMEQSYVQWYFDENEKLKIQTAKMADTIRTLERSKFEFEQSVRELSDTNK
DLNNDVKRLEQKLEIYTELFDKDSNFHTSLKRRSYQGGENNQEQADEKLI
ENALAPLMEEIKEKDSQIRNLQKLVEEKDVTITSLNKEIDTLETNLASMV
MEKIRGMQIPDDAEKVRQESAASHNGLFSTDSLQELKQAYKLSTQNDKDT
ILSNQHTDGEHDKLNKDQKTLHRLSFFDDSHKIRIGEPCTLLLSTTDVTA
SHDHSTKGPQVSPTPIYQTPTSSGPQSPSKETYLALTSKTVNSPKEESTG
HYEQLYSGSSSNPTSPRSSRPSSNIYQTIESAILDQYRGDDQHCYLKSNI
PPLDSRHGESPPYTSYIESAAAGLGLNRSDVDRKSISNMAENKALVDDMY
DQLALLEDLVSKKNMPPPLSPSAVSPTKTRDVAKPVKVSTSENDTSNDDS
SQPASPNKESGHKASSHIRIPKLSQRQSSRESNLGLPSNTKLLCRTPSTS
SSHSQDSTCIDLSGLDDLLAEVDGHRGGSHAHEKYASVVQESKRRSVSGL
EHKPVLSKTMPVPSIRNTRRRIIKVSGLNRTGSFDSTRVKPKILSSNTII
SHSSSSLPSTTKHRNVNVEIPASRLLDNNTSTSSLATSSSSSVSSVIYVP
DKDGNVSIPPTTGTSTSQDKPQTTSATGPAPTSANDPTSSISATSNPPFR
RPSLKQSRFLTSNSNIGS
Run BLAST on NCBI

transcript from alignment at sc0000001:1890136..1921491+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000101 ID=TCONS_00000101|Name=TCONS_00000101|organism=Clytia hemisphaerica|type=transcript|length=31356bp|location=Sequence derived from alignment at sc0000001:1890136..1921491+ (Clytia hemisphaerica)
TCTCATTCCTGAAAGAAGAGAGGGTAAAAATCTGGTGTGGTTGACTTTTT TGAGCAGTTGACCTTTTTATTTCGATGCAGGAGTGGGATGTTTATGTTTC AGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGA TTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAG ATATCATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTT ATAAAGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGAAAC TCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCATAA CATCAACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAA CCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGG AAGAAGCTCTaaaggtttttattttcatatgtTTTATGTttcatgttttg aatttttaaaaatcaaaacagaagATCTGAGGATAGACGTTTTGTGGGAG AACGCAACAATCTTTTGAATATAACCTAACCAGAccgtgtcaatcgaaca aatcgaacaccgaatcaattgaacacaatcgaataattgccaTTCGATTG TCGAGCGCTATCGAATCGTAATCAAATGTTACCCATGATTTGCCATTCAA TTGCTTCGGTTACGtctgatagaccttttttcaaagaggacttcctgttg aataattatgtagtccagccataaaaacaatgatagagccatgcataatt actgtatcatgcatatagTAATAATTATgcgtggttttatcattgttttt ctgctggactacataattatAGACCTTTTCGCCTTTGCGTCCGCCATATT GAATTGTATGCAAAAATACAGGAACGAAAATgccgtggttggatttagtt ggaatgtatgcaaaacatatgcaagtttacacaaagattaaaaagacaac aaagcatcttataaataaatattataatcattagaatgataaaagatgga atttcttaatccaaaaggaaatatttacagaacaacaaaagcctttcagg aatttgttcttaaagacattgcatattctgttttcatgccattaagaaat tccacgaagacggagtacacacatcaaactttcaaacttgcaaactgaaa gcagtaattatgacgtcacactttatcaatgttttgatttgatcgtctga cggttctattcccaggagaataatttgctgtcagccgaataaggattgtt ttttaccttcgcgggtgatttttcagttNNNNNGagattctgtctaatgt tatggtcttttgaagtgcttgttctaagagatgagtgaatataattgttt ttagttttcaagagaagcaaatttaatctttctaCTACAAGATTACACTT TAATATAAtgccaattatgcatgtaagtttttaattaatactttcttttt gcatatgttttgcatactttctaagggaatttcaccacggcaattcggca accataatttttgcatacaattcaatatggcggacgcaaaggcgaaaagg tctattcaacaggatggcctctttgaaaaaaggtctattgctgCTTCAAT TATTAGGTTCAATTGATTTGTGATTACCTTGGCTGTCATTAATCACTCTC GTCATGTGCGGTACTAAGTGCTCGCTCTTCTGATTTTCTAAAGGCAATTA AGTCTCAATCGAACGCCATCTAATTTtgtcatagcaactatctggtcgtc actatgttccaattcacatccttctaaacatttatcatgcaatttttgct tCTCATGTTCGCTATGCTAGTCAACTCTGGGGACTGTGTGACAATACTNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNcaaaacaatggaatgagttactaataaatcatcctgac actgattttcacaaccttgatactgatgaactaaaatctttagctacaaa attctatttagacagttacatcaatatgccttcttacctgtctttaaaaa tataaataaaagtaatcacgaaaAAGCacgcgaaaaaaaagacataagtg tgagaacagagtaatcaaactcgttagaaaaagtaccattagaagtcata aaaaatcaacctgaataaatgcaatcgNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtattactatgtcaaactccc attacataaattttacaattacgtcagagtagactacgctcgccaccgaa gaggtttatttggaaagggtaattacattttattttttgcttctttttta aagattggccgggttggaaaagtatgaatttctttgtacatattttacct accccaaatctttaggaggctgagttttaaactaatcgtcaagttgaaac gaacgataaatgtatcaaggtctgttttatttaccccctggtgacttaac aaaagagacttaactcgatgttacaatcAAATTATtgaaagtttgtctcg gcctttttataatgagcgagacatacgttctctgattacgcaattttcat attgacattttcgaggcattttgatgtaactgttagacaaatacaaagct gaagacaaataatctttgtgtgtgtgtgtgtatgtgTGCGTGTATTGTGT GTGCGTGaacttagtgtgttttcccagggtgggagggggtNgttccccat tgtattagagaaatctattttttttgtaaggggttatcctgctgtgttgc agcgaaaatatattcaattcaattcaattcaattcaatttaaatgtttat aaataaaacctTCTGAgtaaccagacgatctcaatcgaacggaatcgacg atcgaaccagtcgaaccaaatcaaacacaatcgacggattgaaattcgat tgtcgaacgcaatcgaatctcaattgaatattatcgcaattttcagattc gattgatattcgattgcgttcgattgatgttcgattgcgttcgattgatg ttcgattgcgttcgattgcgtttgattgagatcgtctggagttgattgtc tattttttgccgccatctttgttttgacggttagaaagcagtatggtttg atcaacaatacgcttccgaaccgggcaATGTTTTCCGATAACAACGACAA TCAACAacgacaatcgaaccaattgaatattacccagaattttgacgttc gattgagattcgattgcgttcgacaatcaaatttcaatcggtcaATTGAG TTCGATTTGGTTCCACTGGtccgatcgtcgattccgtttgattgagatcg tctgggagtaagctgtttaaaaaatcaCTCTTATTGCTTTGCAGACCAGA CAGTTGCTATGGCAGAACTAGATAAGGTGTATATGACAGAATTACACAAG GTTacagtaccgtcaactgctctaactttgtactatctgacaaaacatgg gacagcaattcggccaacatttcaccaaacctccaaagtcatgcAAATAA TGTGAATACGCTACTATCACCAGGTAGGCTTAAACATGgcaaataaaaga aacaaatcTTTGCGACGAGAAACGCGTAAATAAATGCGACTGCACGCATT CATGCAAGCGTCCAAATACAGATATAAAAAAAGTCCGTTATCCCCTGCGG AAAATTGTGTGATCTGCTATCGACACTCGGTAACTTTGACATGTTAATCA ACCCAGATTAACCACGCACGCTGGAAAAAAGTCtctaaagaaaaaacaaa caaaaatggcgTCAAGATGTGATGGCGTGTgtgattaaattgttaattaa CTTTTAAATGTAGCTGTTGAAATGGAGCAATGAATTTTTCCCTCAGAGAG GAATGGTAATCTTCCTTTGGATGTGCTTTATCCCCAGTTTAGTCGGATTC AACTGCCAATTATGCGTAATCCTAATAAATGATTTGGGCCCAGTCCTATC GCCATGTTCCCTTGGTATCATTATATATCATTTACTTTCAGTTTAATATA AATTGCAAGTAATATGGTTTGAGTTTCATTTTGTTGGTTTATCTCATTCC TATCATATTTGATTAATAAGCTATTATAAtttttaaagggataaccagCT ATTTTTCATTTCCATATAATGTAGTTGGTAATTATAAGAAGAAGGCTTTC CtacacaatattttgaaaaattaggaattagaagagaaaaaaaaggtAGA CTTTCTTCGTTTGTTTTTTTCGGTTGTCACTTCTTTGACATTCGAAAAAG TGACACTAAATTGtataatattatattttgtaATATAATCATGGTTAAAC TTAGTTATATATAATGATTTGAGCAGTACTGTTTAGAAGTGAATTCAATA ATTGGCTAATCATGTATAGTATGggaaaaatacattcaaattaTATGAAG TTCTCATCTTTGTTTCTATAGAAAAAAATGCAAtcgtttgtttaaaaata aactgTTTATCATATTTTTATCTGGGTTGCATCCTGTTTTAGAAACAAAC ATTCGGTAGGGTTATAAATAAACTATTTATCTTCGTTAAatctttcttta taagaaatcttAATATCATTAAAAaccaattatttttttgatttgtaatc TCTTATCTTTTTTTGAGTTCCTATaaataaaagaattaaaaataataAGT TGAATGGGTGCTTACTTTAAGTTGAATTCCGTTTAGACAGATTAATTCAA AATAGTGAGATTAGTAATAAAGTGCAACCCACcttattttttcaattaga CGTTATGAGTCACCAGACTTACTGAAACACAACCTCTGACTAGCTTTGAA TATTATTGAGTTATTGATTTCCAATGAGGTTAAGTATTTACTCATTCAAG CAACATTGAAATTCGTCAGTTAGATTTTTCCCTTTCCAACTGGATCGAAT ATTTGGAATGATTTGATTCAAAAGGCTGTTAAAGTAATTAAAGAGTAATC ATGCTTGAGCAAGATTATCTTTGATAAACGTCTCATCTTATTCCTTACAA CTCTAATGCGTTAAATTttacaatacacgtttttataagagcaaactata taaggcttcgaaggccaaaatgttaagaacaagttaagaacattttaagg ctttgcagactctagaacatcgaatttcataggaaaatggacaaaaatac ttaaaaaatggtgaaaatgagaacacgttaagaacatttttaggcttaaa actccaaaagttaagaacatccctaggcttcaaaaatgttggatgttctt atgaaaaaaacgtgtattcgcaaagaagtgtgtcaaaatcaatttttttg aaaggagATTCCTGAGCTTACAGCCTTACAGTCCCTCTGTAGGTCAAAAC TTTGGTTCAGATTATACATTCAGTGTTACTGAAAGTTTTGACTATTCCAT CCAATGATGGAACCCTGTGAGCTGACTAGTCGAAAGTGAGAAAAATCAAC CTGTTTAAAACCTCGTTTAGAATATCTTGAGCTAATGAAGTTCTTTCAAA TGCAATAATTCCCTCTCATATGTTTCATAAGGGGATTTTCATCGTGTATA TAAATTctcggtggaacttttttcttcagtggggataaaaatgcctatcg aaatcccaacggggatagaaatttcattgtgaaaagaaaaacccagtggg atggttttgtagttcaatttttagacattgattttcgagtggggatgaaa tcaaagtcaatttcccatggctggaaaatttttgccaaattttctagtgg ggatgaggtcccagtgggtctgtgacacaggagtgTTTTATCATGGTAAC TGATGGCTACTGTGAAACTCTTCATCACTGGACTCCTTTATAAGACAACA CTGAGTTTACTCTGTACCAGattgtatctcacgtttatcgcttcgtagta cactctgtgcgcattgtctgtttgataaaaagattctcgttcggagacct ctgcgatgaagtataatttataaatagcaacacttctctcatcgtctcgC CTTTCTCACCAACagcaacactccatcgcagtggttggtttgaaaaatct caaatgaaaaAAGACAATGGCAACAGAAATatgacaatgaattttgaaat tagccgtagatactgggtctgtgtacagacaacacTGAGTTTGGCTACTT TCTCATTCATCATCTTCCTaggaaaacttaaatttttgagGATACTGTGT TTCATTGTGAACAAAACAGGTTTTATTCAGTGATTCTCATCTGAAACGCT TCAATCAGACCTAAAAAATTGATATCATCCTGTAAACAGTAGCAGCTAAC TTATTTTTGATGGATAATTTGTTTTTGCAACAATCTTCTTCTGTGAACTG TAAAAATGTCTTTCAAACAAGTTCATTCGAAAAGTCTACCCAGCTCTATC TCTTTGATTATACTCTGTAGaatgaaaaaacgaaaaaagctCCAAAAATT CGGAGAGAAGGTTTGAGACCGAAAATTTGGATTGTGATCTCCCTAGAGTT CACACTAGGTAATCAACTCTCAGGATGATgacaattaaaaatttttaaaa tttatatgtgatctaatcattttttttcagtatttcgacaaaatctcaaa tttttatttattttgtcatATCAATTcagttcaaaatttttacaaagtaa acattgTCTAAGTATTATGCTTTGTAAGTGTTTCATCGATGCCGTTTGAT TTGTATTTCAatgtttgttttaaatgtttaccTTTTAAGTTGACGCGTGC CTCGTGTTTGTTTTGTGTAcgttaaggaaattttttttcaaaagatatcg TATTTCTTGGGTAATAAATCACACAGTGCAGTACGTAAAATGTGTTTTGT CGTCTCTAATTAATAACCTTGCGCTTGCTTGAGTTTGTTAATCCTAAGTT CTagtcaaaaacgtcaaaactaAGCTTTTACTTTTCACGTCTTTTGACTT TGAACACAACAAGTTGGTCCTTGGTGCATTTTTGTAGAATTATTTAAGGT TAGAcaaatttgatttattgttCTACTACAGTTggcactctctaattcga tgttctactattcgattAGTCTGAATCGTAGAACTCTACAAAACTGCATG TAATAAATACAAGGAGCacaaatccgttagtggatgccagcagcctacta TTCGATGCGCTCAATCATTTGACAGTATTGAAAGCCACCGTCAACaagac actctctaattcgacgctCTACCATTCGATAcgtttattcgatgaaaatc caattccccttgaacatcgaattggagagcgtcaactttatattcatgat attcatgatgtaatcttttatacggaagcacacaaaataatccggaacta gtggcaaaatttgccactagtcttttgttattttgccactagttccgggt tatctcgggtgtttccgtataaaagattacgtcatgaatatcatgaatat acgAAAAAACAGAGTACGCGTCGGTCGGTCTAGCGTCAAATACATACGTT GAAACAGCGTGCTTATGATTTTTTCCCTTTTCCTCTTTTAGAAAATTCAT TAGATGTAGATgtcaatgacgtcatgaaaGGACGGCCCGTCGATTCTGAG AACGAGGCAGACGACCCGCTGACAGAAAATGAAGGAATGAACACTCCACT ACTCACTAGAAGGAAAAGGGTATGTTAATCACATTATACCTTCATTTCTA GAGATCTAGGCCTTTTTGCCGAATTCTTCCAGGAATCAATCTTATGTTAG GCTAATTcgcttttttcgcaaattttagaAAGCTTTGGGGAAGAATTTCA TAGCCGTTCTTAACAAGTTGTGTAATaagtcaaatttaaaataattccTA ACTAAttgaaaactgaagaaaaagaaatgaagCTAAAAGTTGTGCAGTAT TATAAACATAGCTTACACCAAGAAAATTATAAGTTGTGTAATAAGAAGGT AAGATAAGTTGAAACAAATTCCCAACCAATTGAAATTAGAAGATTAAGAA CTCAATATTAAAATCCATTAGAAAAATAAGCTTATACACAACTTGCAATC TCTGAAACTTGTGTATTATGTATTGTTCAAATAAAGATTAATATTCTTAT GAAGTGCTTGAAGGCTGAAAGAAAGCAGTTTGCAACTTTAACAGTTTCCT GGTTGACTATATACGGAGAGTGTTTTAGTAATGATTATGAATGCGAATGT ATACTTACAAACTGTAATTACGATTTGTTTCCCTTGTAAAGTTTGTTAAT AATGTATAATCTTGCTTGTACGTGCTTTGGGTTTATATGTGTGTAGTGGT GAAGATGTCTCTATTGAGTTTATTTTTGCAGAAATACCTTCAAAATCCTG TAAActagactttttcataaattacgtccctaccttgttttcaaaatatt actatGATGGTAATAGattttatcggagtttttgatttttctaaaaaagc gatgcattgtgtgATTGTTTctgggtattacaatagaaatcccTTAGGAA Attctcgagggaattctattgtaatacccccgaaacaatcccacaatgca tcgctgttttagaaaaatcgaaaactctgataaggtctattgaTTTCATG AGGAGTTCATAAGAAACTTACTCAATTTATAAATACTTTACTTAcgtaat ttttgtaaatttttaagaGTGACCCTGGAATCCTTTAAGGCATTTAACCT CCTGTTAAATAATGgattcaaaacgaggcagtcgttgcacaCAAAATAAT TTGCGAAAAGGCCTATTCGAGGCTGAAATACTTCATTTCAAATGTTCTTT TCGAGGCCCCTCAAAACATGTATATTGTTGTTATTAAACTAAGTATATTG TATTGTACGCTTTTTCTCCACTGTGTGGCGGCGCCATTATGAATGACAAA GTGCACTATTAGTGGCAGGCTCTCTTGCCCATGTCTGAATTCTATTGTCT GTGTAATGATTTTCTGTCATTTTTGTTGACACTCGTATTTATTTTGTTTC TTCAACGTAAACAAAACCTTTCAAAAAATGTCCCTTTGTTTTGACTGAGT GGCCaaacattttcttaaaaagtgtTTTATTGCGACTTTTTGTTTTGGAA ACGGATATAAGGATTAACGAAATTTCAGGCTAATAGGGTTTTGCATCATG TAATTTAATTAGCAGTTTTTAAGGCATTTTATTAAATGCAGTCCAGTCTA GCTATAGTTTATacactgcttttataagaaccaaaatTTTACTTGTCTAA AAACAACATGGCGATATCTCACTTAATAAGAACCATAGTTTAAAGGATTT TCATTTCATTGGTTAGAAGTAACGTAGaacttgaatttaaccaataaaat ggcttcatttcgttttggAGCGTAACGGAACTGTTACATGTGAACGTAGC CTTAGAAATGTCCAAAATTTGATAATATTATAAACTCTTGACTGTAGAGA ATGCTATTTTAGAGCAGCTGTGGGGCTGAAAGTCTTgttaaaagttaaga ataacTGACGAGGCTCAGTCAAATTTTACTGGTCCTggggttcttataaa aagaataacACGTATTCTTTTATTCAGGCAAATCAGTaattaaacttttg ttttgacaaaaaatagtgaaaatcgaaaaaatatgaaaacacTCACGGGC CTCCCTAAATATCCAGATAAACCTTTAATTACTAGTTTCGCTGTTAGTAG GATAATGTTTTTGCTTAAATTatctttttagttttaaattgGTTTTTATA TTGAAGGCTTGAACAAAAAAATAGTTCACTTTTTGTTTGCTACTCACAGT TCATTTTTAACAAAGTTATGTGCCTGAGAGAGTTCCTTTTTCAAGTATGG TCGACTGGTTTGAGAACTTCAACAAACTCAGATCTTCGATCCTCTCACCA CGAGATTCTGTAAGTTTTGAAACCTTAACTTTGATGATCTTTACTGCATG ATAGTATTGTTCAACAAGTTTCTGTTATTTGTTTTTTACACTTATTACTT TTCCTCTTCTCAGTCAGTCAGTGACGGGATTATGAAATGGGCTAATTCTT GAGGAAATTCATTTATAATACTAGAGTGTTGTGGGGGTCATTTGTTAGCT AGaccccactggatttttgaataatttttggaTACCCCGCATGAGTTTTC ACCGACAGCACACAACCCATGGATTTGATTCTCCTTCTCGACCAGGAAGG AGCCCTTCCCctgagttttaatttttttaatctggTGACCCTCCCGAACC ATTGGAGCGGCCTCTTTAAGACTTCTGATTTATATTAACTCCTTAGAAGA GGTTCTTAAAGTCGAGTCCtttccttttttaatttttttattgtcatttt ttaaaatttcacaatcGTGATGCCTCAACCTTCCTGTTTATTTCTCGCAC TGTTATTAAAAAATAGTTATCCCTCTAGATAAACCTGGTCATCTATATAT CACCTGAGACAACGCAGAGAAACCATTTTAATGACCTCATTATGGCCGTA AATCAATTTCGGTATCATAATGTTAATTGGTTTTATTGGCAGACTTGCGG ACATTCCACTATTTCTCTTATtctgtcaaaaaagttttgtttttttcttt tcttttttgtgtcTTGTGCCGTCCgccattttgtgtttttttgtaagaat ctCAAATTGTGTTAAAGATTTACTGTATtgatacaatttttttaaaggtt attTTAAAACAACAAAACGCCACGTTGGACAGATAACTCTGAGTGGATCA ATTTAAGGTTGTGCATAAAAAAATTCTAGGCTTATACTGTCCCTCTCATG TTGTCTTTTTACTAATATTTACCTGGAAATCAAAGTTCAGTTATCGCAGG TCAGTACCTACCCGGCATGCTCTAACCCTATCTCCCGATCCCCAACCCCC TAGATCCGAAACTCtgttaaattttcttataagaatttaAAACTGTCAGA ATTTCTTCGGTAATACTACTACACTTCcaaaaatgttattttgttttgtt tttttcacagAATGATAGGCTCATTAATAAGTATGTATTACTAGTTAATT AGctcaacttttcttttttacttgaTTGCTTTGTCTGCCATTATTGTGGT CTTTGATAATGTTGTATGATGATGATAATGCCTTCGTTTGTATATCTGTA TGATGATGATATGGTAATGTAGTGCCTTGGGCTACTTTCTATTTGGTGTG ATTTCTTGCTTGGTAATTGTGAGACTATTTGTCAATTCATTTAAACGATA CCTTTATGTATTATAGTTACTAACTTGGGCTACTTTTTTATTTGGTGTAA TTCCCTTAAGAATACTTTAAATGCCGCTGCTTGGTTTTCCAAGGTTGCTT TTAGTCTAacattgttttaacgtttatctaacttTGCGTTGGTTGTGTtg atttcttaatttttatttttttaatgctGTGATTTATTCTTTGTTGGTTG TACGGTAATACCCTTACTTACAtggttttttgtaagaacaaactttataa gagcATAGGCTTTGATAACCgacatattaagaacaagttgagaatatttt aagactttATGGATTCTGAACatctattttcttaggaaattgcacaaaaa tgatcccaaaatggtgaaattaaggcTTAAAGTCAggctttaaaactcaa aatgtttAGAATGTCTAAAggcttcaaacattttggatgctcttataaaa aatgtgtgtttAACTGTCAGTGCCCATATGGCAAAACGTCTTTTCAGCGT TCATCTAATGTTGATCGTAATGGATGTTAGATTGACGTTGTTATGACGTG ATGTGACAACCAGGTATACAGTTGAAGTAGTCATTATCAATTACCAATGA TTCTTTAGATACTTTCATATTATTGCCATTTTCCTAATTTACAATATAAC TTCTTAACTTGCTTGATGCGATTTCACAAATAAAGCTGTACTTTGAGTTA GGCCTTACTTGctccttttttctttagttatGGGAATTTTCATAGAATTG CGATAAAATGGATCATTAGTGGTTTTGGAAAGTCAATCTGATAGTGTAAT TACAACTTAAACTCTTCATTACGTCATCAAGCGCATTCTTTGGGGGTGAC GGCATAAAAACAAGCGGCGAATGGTGTAGTTGGGAACTTGAATTGTGGGT AGGATATAGAGTTCGGTTTCTTTGAGTCTGTCGGTGAAGCCTTGATGAAT GTCAGCTTGCCAGAAAAATTACATCATTGGTTGGTTGGTAGAATGTTTTG TCTCGTTTTTTCAAtgtcgtttttcattttcattcaagattttgaaaatt ttttgactttgtttagTTTATTAAGCACACATAGGTGTGATCGAAGTGta tcattttgcaaaattttggcaggaaAAAAAAAGAGTAAGGACAAAGAATT CTCTAGCTGAGATATGGTTAAGAAAATACCCATTTAAAGTCCCTCGCACG CTCTCAAGTGAAGAAAGGAAGACAAGATAAGAACATTATGAGACTATTCT AACTATGTATAGGTATATCAAAACAGTTGGAACTCACCCAAAACTTTATT GGTTCTTagaaaaaaagtgtgaaaattcGTTATTAAAAAAGTAACCCATA TGGGAGTGAGTGATAGGAAATTTATTTGGAATTCGTAACCGATTAAAATT ATTTGTCTACTGTCATCAAAATATGTTCCTATTTTCGTGTGAAGGTTAAA AATAGGTTGTCGGTATTTCCTTTTGTGTCACTTTCCAACacacaaaagaa ttttgatagatattttatattttgacaaatatctTGATGTCTGACATTAA TGATGTCCATGGTACGTCCATTTGACATCCATAACGTCCATGTAAcctta aatgaacgttgaaacaacgtgcCGTGGTCTTGATTTGACTGTCTTTTTAA CTTAAATAATTGAAGATTGAGTATCGGCATGCTAGACCTCCGTATGATTA GTGCAAACTTAAATTTaacttattttttgtttaaaggTTATATTTACTGC TTTTCAACAGGGATTTTTCAAAGTCGTTTTTTAAAACCATTTTACGTTGG CAGAAACTAAATCTGAGGATAGATGAAGTTGCTTGGGAAAATCNAACCAC TTTACGTTGGCAGAAACTAAATCTGAGGATAGATGAAGTTGCTTGGGAAA ATCTTTGAAGAAAGGGCAAAACTTAAATTTgaagcattttttgaaaatgt cctTTTAAAATTATTCGAATCTTATTGCCATcgagacattttttaaaagt ttttattatagagtttttcttttcatcttcagAAGCTTTGTAATCTTAAA ATGATTACAAATTCGTCTTAATCAAAAATTGCTTCATGTTTAATTAGCTT AATTCTAAACAGGACATACCTTTCTTTCCTCCATAATTTCTCTTCTATAC AATTCGGTCTAGTGAAATCATGGTTTCATCCATGGTTTTGAGTCCCCCCT TAAAACACAAATCACCCCTTATCAATTTATCCCCCCTTAAAGCTTAAAGA TGGTTTTGAGGTGCCCCTTAAGTTTTTTGATTTAAAGAAGTAGACCAAAT TTTTAGTTGGTCTACttcttttaatcaaaaatattttcgaatgtaACATT TGAATCGAAATAGAAAATTCCATAGCTGAAATGTGATTGGAGCCTTAGAT GCTTTGCAAGATCGGGACACAGCaggaacaaaattattttagaatgaggt aaaaatgaaaaaagtgacAAAGAAATATCAGCTGTTGGAACAGAAAGGAA CAAGATTACTCCCCCCTCAAGTAGCAAAGGGCTTCCATTTGACCCTTGAG AACAAGTCCCCCCTTATTTCtcagtttttaacattttttccccttgtgtt tttctctaaattttaaatcaccccttattttaaggggggggctgaaacca tggAAATTagacgcatttttttttcaaatacagtGAAATTGTTTAAAACG TGAGGAGTTCttctttttgtgaattttttaagGCTGGCATGTTGTTGATA ATATATGGATAGACATTCTTTAAAATATGCTGTTTATTACAAAGGACTTT TAAAATCAAGGACTTGTTTTataaactctttttttatatgaatggtgttt tttcatttcatcatggatattcttaacttttttgggaaaatcatcctaaa gtattcttacagcattcttaggttagagtCAAAACTCAACCAAAATTTAA TAAGAAATACACACCTGAagcaaaaaatggcatttttgtgaaacttTTGA GCCTTACTGGGGGAAACTggaaatttacagttaaaattgctctgtaaatg gcattcttagattTCGTTGCCTTATTCCACGATGGTGATATTCCTACgat attctaatttttttggtcattttcatcatggacattcttataaagtgtat tcttataaaaaatgatgatttttacCGTCGTCCccagtcagtcaggatct agaaaaattaaaaactaacCTTCTCCGTTATAGAAAAGCGCCATAGATTA ACTCGCTTTTATCTCCACCAAAAACCCGATAAAATCCTAGCCCCTCACTT GCCATATAATGCTAAAACCCGGACCTCTCCTCTTCTTTAGTAGTAGAGTG TACTTTTATCTTATGGTGAATACAGTTGagtttctctaattcgatcttca aggggccaAGAATCTTCTTCAAATTCGGATTACGGAGAGTATTTTGTACC TTTTCCAGCCTGAGGGGACCAATCTTttagttcgaataatagaagttcga attagagagagttgacatAAGCCTGATGAAAATCAGTAAATAAAATTCCA TAAATGATTGAGGTCAAGCATTTCTTTTTTATCAGATCATAATCAgagag aaatcagaaaaaatatacatcatattttgtgaatttttacaCAATAAACA TCAACCATCAGCCCACACCTTGTACACATATAACCTTACAGTCACGTATA GATGAACTGCAAAATATTCAACGTGCGTATTTTGTGGGGACTTAATTTTA TAGAGTTTATGTGGATGATTTAAAAGAGGGTACTATAGATTTAAGACTTA AACTGATAGTATAATTTCTGGATAAATTTGGGGGGATTTCATAGTTCATA GTTCTGCTTTAGTCTTTAAATCGCAAAACACGTCTTTTTCGGAGGATGCT AATGGCGTATAGTCTGAATGGCAGACCTCTAGAAAACtaggtttttgaaa aatgtaggTTTGACTTAGCACTCCTTGTCTAAGACTACCGTCCTGTCCGT TTGAACTGGAATTTAAGACAAAAATAGATATACCTATCAACCCCAGCGCC ACCCACACGGGGAACGGGCTCTAGTTTACCAAGGTTAAACATAGGTCAAT GTCTGTCTGCTGAGTACGTCAATGCAACGATCGTGTACATTTGATTTTAT TCGAACCTCTGCTAGACACGAACCCAACTCCCTTTTGGAACACGGGCTAC TAGTGAAGTTAaataaatcggtaaaatcacgatgacgaacgaaaatttaa caggctagtgagtttcaaccaatcaaatttcgtattttcactagcctatt atatttttcgtccgtcgtcgttattatcctggtatgcttaacctcagtag tATGTTTATTATGAGGGGCGTAGAGATGGTATCGGAATGTTCACGGGTAA AAAGTAAAGACGGCTAAAAGTTTATGGTGTGATCTGAAAAACCCAACCGA TTTCNAAAAAGTGAAGACGGCTAAAAGTTTATGGTGTGATCGGAAAAAAA CACATGCATATTATACAAAACAATCTTAGTCATCAAGTTAGAAATATCAT ACTCGAAAAAATAGATTATAAAATATGAAGGATCGTCTATATTCTCgtga aaagaattatttttagaAAGTCACTCTCGTAATAATCTTGGTTAGGGTGA TGTAAAGGTCGCGTGTTCTGTTTATCAAGAGAGTTCTTTTGGCCATAAGG ATTTTGATTTATAATACTCATTACTCTCTCGGATACATATGCGTCAATAG AggaattttttataagcattttgaaAGTGGTTTCAGTATGTTGACGTTAT TTCCTATAAGAATGTTTGTTGTGGAATTGGGTTTAGATGTGAATGAATAA TAAAATGCCATCAGGAATTATTTTCActtctcaaaattttgaactttttt cgaGCCTAAGAAAAAGAAGTTTTCTAATGGAGCAACTCgaaactctataa ctcgaatatctccttaactcgaacaagttttctagtcCCTTTAGTTGTAA ATGCCTATCCATATAAACTTTACTCCagaattcgaacaaatttgatTTCC CCGtgcatgttcgagttatggagaattcactgtattataaaaaagcgtta aaACCGCAATTTCTAAAGGTGAGGAGAGAGTGCCTTAAGCAGCCTTAAGA AACCCTCCCTTAGTGATAATAACCTTATATATACTCATAGGTTTCGAGTT GAGTTTCAAAATCCTTCCCTGTTTAATTCCTATAAAAAAGGGAAGACATG ATTCCGATGATCTCACTAACCGCATATTATTTGATAAATTCTTtctaaaa aacattgaaaatttttatgaaaattttattcgAGAGCTTCTACACTTTAT TTGTCTACGTTTACAacattttggaaataacttaCAGCTCCTTACATCTT TCTAGCGTCTTATTAACGTCACTAAACGTTACGGAATGTCGTATGTACGT TTAAACACTTCTTTTGAACGTCcagaattcattttttgatAAGTTTCATT TTGTGACCACAGAATCAGTTTATAGAACGTTTTTGTCTTCATGTGTGTTT GTGACAATATCTTAATTTAAGgatttttaatatgttttttttttcgttga aaaaaggttttaatATTAGTTGGAGAGAACTAGAAGTTGTTATTGATTTT ATGGAGTCTTCATTTAGAAGGATTTTCTCAgtttagaaatttgaaaattt agcttgtatttttttaaagttcactCTCAATGAACTCTAGCGTTGTTAAT ATTAGcgagttttttatattttggacttttgaggaCGGAGCCAAAGTGAC TGAATCGacttggaataacccgcagttttgactcGCAAAATCGAGTGGTT AAAACGCTAATTTACAGTCGtcttcagtcagtcaggataAAGGCAAATCA AAAACTAACcatctccgtcgcagaaaacaCAGCATACAAAGCTCCTTGAA ATTGACCTTTGTGATGATCCTGATCACTTTAGGATGCAATTCTTTCGATA TAAGTCAATTCAGATCTTGAGCTAAActgttgaaaaagaaagaatatata CTTTACAGCTATTTCTCTGAATTTTGAACCACTAAATCAGTTTTTTTCTC GATCTGGCTAGtcagggtgcagtatgcagtaCTGAAAGAGTCCCAATAAG GatgaaatgcatatgctgcgaTCTCCCGAATGTTTAAAGTTAGACAGAAA TTTACATTTCTTTACATCTACTCTGCTCATTTGGAAAGGCTAAAACCTCT TTCTCTtttatttcttgaaaaaaagtgTAGCATTCATCAGGATATCTGTT CGCTGCTCATTTTGAGGACCTGTTATTTTTCTATTAGAAAAGCTaaacca tttttctttttcttccgaAAAAAACATAGCATTCATCAGGGTATCCGTTC GAACATATGGATAGTCACGAAAACACGGAGGATGGCACGACCACACCAAA TCGTATCTCCTCCAAATCGAGATCCAGATCACGCACGAAAGGGAAAAGCC AATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTCATCAAATTCATCT TTGTGTAGTTACACTAGTGAACTCACTGATGGTAAGTAGACAAACAATAA TGTTCATGTCAAAAGATATCTTTTCGATTATCTGTTATAATTGGGTATAT TGAATACACTGAAAACTTTATGTTTAAAGGACATCGTCTCACGTATCTCC GACCATTTGCTTAtgcagcatttttaaacaaaagaaagaaactttAACCC ATTTTGGTGCCCAACGAGCACATATATTGACAAGTTCTTTTGTCAaatct gctttgtcagcatagagaCACGCTTCCTTTCTATATCatgaaaaagaata tcttttttttataatttagtTACTGGCTTATTACactgttgttttatttt ttctaggTTACTCCGATTACGATTACGACGTTCGCTCCATTACCGACGAC ACTGACGATTACGCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACT TATCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTC GGTCACGTATCATTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTAC CACAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACG CGATATTGAAGGTTGGTTTATTCTTtacccccggggggggcacccgatct gaaaacgaccatacgttcggcccaaaatttggcttctaaaatcggaccct tacagtgcagtgaatttccatgaaaaatcatacccttacagtgcactttt tcaaaatttctcgcaaatttttgcaattttccaagaaaatgtggaatttt tcctccaaaattgaccaattttgtgccaattttaccaataaattggcctt ttatcacaatttcctaccctgagagtgcagttcagtgcagttttgtaatt tcctacccttacagtgcactagctgaactatgaaaaacctacccttaagg gccgaacgtctggtaggccATNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNccccccccccccgggtctttACCAT CTCTCTATCATTAACTATCTTAATTATTAATTATTTATTTGCCACTAAGG CTCAAATGCCTTCAAATTATTGACCAATCGACGCAAAATTTCACTTAAAt accaaaaataccaaaaatagaatgtaaaaaaaacaactaaGCAAAGATTT CTTCATCAAAAGTTATAACCCTTTGAAGTACTACTAGTACTCGTAGTCGG CAGCGAATGTGTTAAATTCTAATCATATATCCTaacctagacgatgctat cgtccgtgtAATATATTTATTATGATATTGCGATCTAACATAGCTGTATA TTATAAAACCTAATATGTTGCGCTGCAGAAAATAGAGTTAACAATGTCTT GTAAATGTGTTTACATTACAAGACATTGAGCCCCTCCAACTATTTTCGCC CGTGCGGACAAAATTTCCACCCGACTGCTAATTTGCGTATTTGAGGTTAT TCTTTATTATTCGAATTCGTCTAATCCTAACCCTATCGATTTACAGGTTT GAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCATTGA AAAGCCGTTTAGAACTTGAAGGTATGTATACAACCCTAAGAATACTCTTA ACAATATTCTTTCACAAGAATCTTCTCTTTTAAGTttgtctaattttgaa agatattttagcTATCAgaggtgttattatttttgttcTAGATAGTTTAA GTTTGGTCTGAAATTTATCTTACTATCGGGTGTTTAGGGGCACACTTTCC AACCCTCTCCCTCCTCCCGACAGTTAAAGAATTTCAAACCAACCACTAAT CGAAAagcttcattttcttcattttctggTAAGGTAGACTCAACCACTCC GATATAATTTTTAGAAACACGTatattttcttgaataaaataCGAAGCTT TTCGTAAGACCAACTTACATTATCAAGTatagaattaaactaaaattgaa aacatCTTCATATACACactatttgcaaaattttggataattaCACGAGT AAAAGCTCTAGAGAGTTTAAACAATAATGTCGTAAAATTAATTgccctac acgtttttttttatataaggaaccttacctttgctctgagcctggagttc cttatttttacagaaaatttcagcctcaaagttcNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNcagcctgagc agttccttaacaattccttatttttttggaccattttcagcctcgagttc cttataaacgtgttccttataaaaaaaaaaacgtgtatcaggGGAAATAA CTAACCTAACTCGACCGCCCACTAATCGATAATCTTCATTTTCTCTCCCT CATTCATaggtaaaaacagtagaatCCACGACTTGGAGCAACAAAACCAA ACGTTGAAAGAAGAAATACAAGACATTACGAACACACCCAACACTAACGA AGCACAACAAGAACTACTCATCAAGGTAAAAATGTAATAATCTGTTGGTC GCCGAATTGAtactgatgatgatgattttttttatgggTCTTCAGgcttt ataatttgaaaactcTAGGCGTGTGGTAAATATCACACTACTCAAATCTG AAATTTGTTAATATTAGACGTGAGATATAGGTGTACTATCATCACTTTGG ACTTGCATAAATTTATGGtgtacacgtttcttttttcttttttaagaaac tagttttaccaagcagcctcgatgtttcttaagaaatcggccttttgagc cttaaatgtttcttacatgtttctaaactttgNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNcttacatgtttctaaactttgtcaagcttaaaggacgcatgt cgataatacaatagtctaattgactaatctacggtactttcctatcttct atattgattttctattattgaggttcttaaaaaaaacgaattaaaaaatg ctattttttcattctcagcctcagcatgtttcttagatgtttcttagttt ttaggcattctgagcctcgtgtttcttaaaagtgtgtttcttaaaaaaaa aaaaacgtgtatggttGATCCCAGTCCCTGCAGATTTTAGGTGTGTGTAG GCGTGTGTGTGCTATCGCATGGTTGAAATGATTCTGCCTGATCTGAGAGG CAGAAAACATGCATGTtttaacaataattgcttcaaAATTAATCTTACAG GAGAGCGACTTCAATGCCCACGAAGAATGCTTACCAAACTACCCTAAGTG GAtcaattttggcgggaattcaaTTTGCCGAATTAGGCAAAAATCGCCAA AGTAAATCCCTGCCAAAAGTCATATTTTGGCCAATCCctaaattaaatcc acgccaaaatcaATTCCACTCAAACTAGGAGACAAAAAAGGtttctgttt ttaaaaaataccgCAATTTTACGACACCCATCTTTATAAACCCACTATAC GTAATCGTCAAATTATTCATCATTTTTAGGAATTGGAACGAGCACGTAAA TGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaagaaagaaaaag gttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGATTGACATCCTAC GGAACCAGTGCGGGTCGCTGGAAGAGGTCTGTTCAATGAATGTAGAAAGT TCAATGAAAGGCTTTATGTGAAACTTTTGTCATATCTCTTACTTttagaa aacttgaaatttttcatgctATGGATTTGATGTAACAGTTTATTTGCCTT TGACCGCCCTTTGAGGCGTTATTTGCGGTCACTTTATTTGTTATTTGTTC GGCCGGTTTGATTTTCCTCTACGACTTCTCGTGCAGACCTACCTTGGAAC GTCTGAGTGAACAATACTTAATATGGTGGCTTCTTTACTTTTCATCAATC TTTATCTTTTCAAGTGTAAGGTTTAATTTAATTGCTTCACTAATCTCTAC GTTAACTAATTAACTGACATCATGACACTCGCATGCATTTAGGATTTAAC GACAGAACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCG ACATGATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACA ACCAAAGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGTA AATTTCCCAGCTTAACCCTTTCGCCTGAATCATCATCTAACCTTTaatct accttatcggggaaaacttcgtcgggaaaaATGACCAAACTTTGGCCAAC TGACGAataattttccccgacgaaaattttccccgataaggcaTGCTACT ATTCGTCTTCGAGTCGGTATTTAattaaaacaacaacaaaataccgCAGT CGAGGGTAGCCCGAGTGCTCCTTTCCCTTAGCTGTCTACCGATGGTAGGG GATCCTCCTTTCCTTCGATTTCTCCACCTACCCGTATCAGTTCCGTCTTT TTAGTTGCTAAGTATAAAACAGAGGTGGTCTTTTGGGATCTTTGACTTGT CAGGTTGGTTAATCTATAACCGTGCGCAACGGAGCCAAATGCTCTACCTT CATTTTACTACCGTATTATTAcccttttctttctttcttactATGATAGG CACATTGAAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACA AGAACTTGAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCG AAAAGAAAGTATCTGTTCTGCAACACGAGGTACAatacaattatttttca ttcgTACTGTTAAGCTAAACTTTTTAATCTctaaatttttatcattaaaa attaCTCTAAACACTATATTCCCTGATCCTTAGCAAGATGATAGAATTTG ACAAAGTGATTACATTTTCGCCCGAACAAAATTCGCACCCCGTAAAAATA GAAGATCTAAACTCAATTTTTCCATAATAACTCATTTCCACCGTCGTAAG AGTTATATTTTTGGGGATACATCCTTCCAGGCTTTAATGTAAAATCTTCT GATcgattacaatttctttaaatcTCTCGGGATACACATTCAATAAAGTT CACCTGCTTTTAACTCTCTTTCATCTATAGGTTATACACTGTAACAAACA GATCGCTGACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTC TTACAGATCTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGC AACGGTGGCACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACAATT CTTTATAAATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTA AAGAACTTGAACtggaaaatgataattatttaaaagaaattaaagGCGTT TATGATAATTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACA GATAAAGGATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaa atgcgGAAAAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGTGAA AAAGAGAAACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATT GTCGCAGTATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGG CACGCATTGCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCAAGT GACGATTCTGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGC AAGGTTATCGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGA TCAATTTGGAACGAAAGGTTTGTATAACGCTAATTCTATATAGTGCACCC AAACTCCTATTGTTTCACGTCATCATACACGGGTATGGTCTTGAACCAAA ACTTTTTGGCATTACAGTTGATAGGAGTATAATAGATTCAACCTTGATTA TTCTCTTTTATTAACGACCACTCGTAAAGAGGTCAGTAATGAATGATGAA NgtttatttggaacctaagtgTAAACCATGGTGATTGGTGCTAAGAATGA AATCTTATTGGTCGAAAAGAACATCACACAATTTTCCATGGGAAGAATCA ATTTACATTGGTTAAAGTAATAAAGTACCTTTGTATGCTCCGTATTTTTA GCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTCCATGGAAC GCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACGCATTAGAA CGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTATCCCTTGAAAA TGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAATACACACT TAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATTCGTGTACGTTC CGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAGCATT GAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGTGACGTCGAGTT TGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGTACAGTAGCTCTTT ACTCGAACCCATACCCCCATACCCAGGCTCTTCTCCCAATTGAGTTTtag ttttcacacaaacgccagattgaaagtatAATCCACCACCAGATTTCGGA AAAAAGCCCTTTGAAAATAATCATTCCAAAAGCGATGTAAATCTTGAGGC TTCGCGtgttcttgcttgagaaagttTGAAGTCTCttttctagcccttcg gggttTAAGTACTCTCCCTTtcctagaaaataaaaagaacagtCGCACTG TTATTCATTTTTCTGTTACTTTCACAATAGGACAAATTGAAGCATTTCGA AAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAAGTGAAAATGGAAC AATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaaactcaaaatacaa ACAGCCAAAATGGCGGACACTATTCGGACATTAGAACGTTCGAAATTCGA ATTCGAACAAAGCGTCCGTGAATTATCGGACACGAACAAGGACTTGAATA ACGACGTGAAACGTTTAgaacaaaaacttgaaatataCACAGAATTATTC GATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAGGG TGGTGAAAATAATCAAGAACAAGCAGAcgaaaaattaatagaaaacGCCC TGGCACCATTAAtggaagaaatcaaagaaaaagattcACAAATACGAAAT TTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCACGTCCTTAAACAA AGAAATTGATACACTAGAAACGAATTTAGCCTCGATGGTAATGGAGAAAA TACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAAGT GCTGCATCACATAATGGGCTTTTCTCTACCGACTCTTTACAAGAACTTAA ACAAGCTTATAAACTTTCTACTCAAAACGATAAAGACACGATTTTATCAA ATCAGCACACAGATGGAGAACACGATAAACTAAATAAGGATCAAAAGACA CTTCATAGACTCTCCTTCTTTGATGATTCACATAAAATTCGTATCGGAGA ACCATGTACTTTATTACTTTCAACTACTGATGTAACAGCGAGCCATGATC ATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAATTTATCAAACGCCG ACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTTAGCACTAAC ATCAAAAACAGTGAATAGCCCGAAAGAGGTAGGTTCAGAATTTTTTTCAG TGAAATAGCGTTACGATATAAGTCTTTATATTACgattcacttaaaattt taaagcATCCAGTCAGTAATTTTATTTTACACATCAGCACGCATCACTTA ACGTTACATAGACGTTTTTAGATGTACTATGCAAGCaagaataatagttt ttttatacgaacatcaaaagtttttgaagccttcgggtgCTCAGaaattt taagagttttaagTTTCGAATGTTCATGAAGATTTTCtcttttcactatt ttgtgagtatttttatgCAATTTCCTGAGAAAATGGTTTTTTAAAACCCA CTTTTCCTTATTATCTTAACCATCAAAgccgtgttcttataaagtttgtc cttgtataaaaaatgtgtagtcAAATCTCATTTTCTTGTTTCACAGGAAT CGACAGGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACA AGCCCTCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATC CGCCATTTTGGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAAT CAAACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACG TCATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGT TGATCGTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATG ATATGTATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAAC ATGCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGA CGTCGCTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACG ACGACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCA TCTTCGCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGA ATCAAATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCAT CAACGAGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGG CTGGATGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGC ACATGAGAAATATGCCAGTGTTGttcaggtttgtttactttatttttatt cTATGTTTTAGGGGTTTGCATTGATGGCTTTTTCaataaagaatttttac caAACGCTTCCTTCTATAATGGCAGAAATCGCGTTACTTTTAAATAACAT GAAAACTCTAGAAAATCCAATGATTGGGAAGAGCTGAATGTCAAACAAGA TATCATCACTCACTTACCAAAAATAagcctattcatgatatgcaacattg caatgtcttccacggacttGGGTCCAACCAGCTGagtggttgaaagtgac gtattgacttattttacgccacttgcaaccaatcagctatctgggtccat gatgtaatgtctaGATTTTTAGAGTGTGAATTGTGTTAACAGGTACTCAG CGTTAAAAGCTTTTAACATACCTTAAGAAGCACCTTTTGATAGGTCAGAG TTTACCTACTACTAATTTTAATTGTTTACAGAGTTCAAAATTTGCCACAA ATCCCAGTATTTTCGGGTGTTTctgttttaaaggttttatttttatataa gtgttcccgtttcttATCAGActcatatttcatatcagaacagtgtctgc ctattgttatattatgctgatataagcaaaatatttctctttttctcctt ttgaccaatcttgctccacatcagtgtcaatccaatgtgaagaAGCTTGC GAAtaaaaattgacgagtaagcaaacaatatcactcttatttaaaaacaa aacctttaaagattGCATCACGAATTTCGTATTACATTTTATAGGAAAGC AAACGTCGTTCGGTATCAGGGTTAGAACACAAACCGGTGTTATCGAAAAC CATGCCCGTCCCTTCCATTCGAAACACTCGTAGACGAATCATCAAAGTTA GCGGATTAAATCGAACTGGGTCCTTCGATAGCACTCGAGTTAAACCGTAA GTATCTacatttccaggctaaaaaaaCATGCTAAAGAAATTGTACTGATC CGTAGATTTTTTACGCTTTTTTGGGATCCTTTCGTTATTTTTCGTGGGCA TAcctgaaaaaataatgatttgcCTCGTACAAATGCGTAGACAACACAAA ACGTCCATGAGACTGACAAATGCGTAGACTGACCGCCTAACAAGTTGAAG CTATTTTTGTACCTACCCAGagttatgttgtttttttttctatcgtAGAT TTGCAGTAGGAAAATTTCCCAGGAAATAAAAAAGTTCTGCCATCCTACGG TATCCTTGTCTCAGCCTGAATCTTATAGTCGACCATTTAGGAATAACCAA ACGATTTGAGATAATTGGTATGCAGAAACCCTCTGTGAGCCTGAGTAAAA CATCTAggtatttttgtcaaaattgtcaaaatcgagatatcacaatttga aattcCAAAAAGGGTTCTCGAGTTAGGCAAAAAGATTTTGAGATTTCGCT CATCATGACACTAGAAGGAATCCACGTGCCACATATCTCAAACCAGCTGA TTATCCTTTCAACAACAAACGTTATCTACCATCTACTTTCAGGAAAATCT TATCTTCAAACACCATCATATCGCACAGTTCATCTAGCCTACCATCCACT ACTAAACATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGA CAACAACACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTT CCaggtaaaatcttattttgaagatttggcGGATGATTATATTCATATAA GCAAgctgttgattttttttacatcaAGGGAACTTATGTTGACAAAAACT TAAGTTTTTGttaaaattcgccaaaattatttCCCGCCAAAATCAAAAGA ATTGCTGCTTCGCCATAGTTAGTTCCCTTTAAGGTAATTCACTCTATTTT CGCAATTACAGCGTTTCCCTGtttctcttaatttttttaatattatacTT AAAAACAAGCCTTTTTCTTTTGCTGTAGCGAAGGAATTAGTTTTATTATT GATTTTCACAACAATCTTCCTCTTTTTTTCAGCGTTATTTATGTTCCAGA TAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATCAACGTCAC AAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGCC AACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTCG ACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAATATTGGGT CATGAGACACAAAACAAACTGACTAAAGTCTTTGAGAAAgagatttctaa aaagaaaatctttcggTCTTCGGCAACCAGGCATGGattttcttgacttt ttaaaaagatgatatatttattttggtatttttgtttgTATGGCAGCTTC ACACTaacccagacggcacacaacgtcaaaacaacgtccatttgacattc atagcGTCCAAATGACggtatttgaacgttaaaagaacgttgtgtgccag ctgggaagcgTCGTTTTAGTTCGCTCATTCGAATATTATATTGGTGTTAT GGACATTAGATGAATGTACAATTGACTCTCGCTTATGCGAACTCAAAAGG CAAAGCTGGATTGTTCGAATCATTAGGCGCCTTCTTGACATAAATATAGC CGCCACCCGGCGTCGCAGCCGCTGAGTAGAGTGGTGACAAACCTGCATGC CAAAGCCCTTATGATAGTTGAGTGGATCTAGATGTCGTtgatttagttcg aattagcgtGGGTTCGCTGTAGCTTTGAAGTTTTGTGCCAGATGAGGCTG GGATACACCGAGTTTcgttttaaacgaaaatatattaatttcttatttct taATGA

Coding sequence (CDS) from alignment at sc0000001:1890136..1921491+

>TCONS_00000101 ID=TCONS_00000101|Name=|organism=Clytia hemisphaerica|type=CDS|length=77712bp|location=Sequence derived from alignment at sc0000001:1890136..1921491+ (Clytia hemisphaerica)
ATGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGATTT
TATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAGATA
TCATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTTATA
AAGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGAAACTCA
AACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCATAACAT
CAACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAACCT
CATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAG
AAGCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtcatgaaaG
GACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGACAGAAAAT
GAAGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATTCATCAGG
GTATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGATGGCACGA
CCACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACGCACGAAA
GGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTCATC
AAATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgTTACTCCG
ATTACGATTACGACGTTCGCTCCATTACCGACGACACTGACGATTACGCC
GATATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAACCCGAGCT
TAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTATCATTA
GCCTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGCCAGTGAA
GTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTGAAGGTTT
GAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCATTGA
AAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGACTTGGAG
CAACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGAACACACC
CAACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTGGAACGAG
CACGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaagaa
agaaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGATTGA
CATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGACAGAAC
AAGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGACATGATG
CGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAACCAAAGA
ATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCACATTGAAG
ACTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGAACTTGAA
TCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGT
ATCTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATCGCTGACC
TGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTACAGATCTC
AAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACGGTGGCAC
AAACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTTATAAATA
CACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGAACTTGAA
CtggaaaatgataattatttaaaagaaattaaagGCGTTTATGATAATTT
ATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATAAAGGATA
ATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgcgGAAAAG
AAGATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAGAGAAACG
TAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCGCAGTATC
ACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCATTGCT
GAAAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACGATTCTGA
TTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTTATCGA
TGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAATTTGGAA
CGAAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTCCAT
GGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACGCAT
TAGAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTATCCCTT
GAAAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAATAC
ACACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATTCGTGTA
CGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGGGAA
GCATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGTGACGTC
GAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGACAAATTGA
AGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAAGTG
AAAATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaaact
caaaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTAGAACGTT
CGAAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACACGAACAAG
GACTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaatataCAC
AGAATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGCGGT
CTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaattaata
gaaaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaagattcACA
AATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCACGT
CCTTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTCGATGGTA
ATGGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGTTCG
CCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGACTCTTTAC
AAGAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAAAGACACG
ATTTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAAATAAGGA
TCAAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACATAAAATTC
GTATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGTAACAGCG
AGCCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAATTTA
TCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATT
TAGCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGACAGGC
CATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCG
TTCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCCGCCATTT
TGGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATCAAACATC
CCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCATATAT
TGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGATCGTA
AAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGATATGTAT
GACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATGCCTCC
ACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGTCGCTA
AACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGACGACTCT
TCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCTTCGCA
CATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATCAAATC
TTGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATCAACGAGT
AGCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGCTGGATGA
TTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACATGAGA
AATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAGGGTTA
GAACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATTCGAAA
CACTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACTGGGTCCT
TCGATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACACCATCATA
TCGCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTAATGTGAA
CGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAACATCCT
CTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATGTTCCA
GATAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATCAACGTC
ACAAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTTCGG
CCAACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGT
CGACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAATATTGG
GTCATGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTA
GGGATTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTC
AAAGATATCATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGAC
GTTTATAAAGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTG
AAACTCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATC
ATAACATCAACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCA
AGAACCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTC
AAGGAAGAAGCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtc
atgaaaGGACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGAC
AGAAAATGAAGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATT
CATCAGGGTATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGAT
GGCACGACCACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACG
CACGAAAGGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGT
TGTCATCAAATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgT
TACTCCGATTACGATTACGACGTTCGCTCCATTACCGACGACACTGACGA
TTACGCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAAC
CCGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGT
ATCATTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGC
CAGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTG
AAGGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTG
GCATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGA
CTTGGAGCAACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGA
ACACACCCAACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTG
GAACGAGCACGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgt
tgaagaaagaaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAAT
TGATTGACATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACG
ACAGAACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGA
CATGATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAA
CCAAAGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCAC
ATTGAAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGA
ACTTGAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAA
AGAAAGTATCTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATC
GCTGACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTAC
AGATCTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACG
GTGGCACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTT
ATAAATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGA
ACTTGAACtggaaaatgataattatttaaaagaaattaaagGCGTTTATG
ATAATTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATA
AAGGATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgc
gGAAAAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAG
AGAAACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCG
CAGTATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACG
CATTGCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACG
ATTCTGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGG
TTATCGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAA
TTTGGAACGAAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACG
ATTCCATGGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTC
GACGCATTAGAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACT
ATCCCTTGAAAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAG
GAAATACACACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGAT
TCGTGTACGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGG
CAGGGAAGCATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAG
TGACGTCGAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGAC
AAATTGAAGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACA
ACAAGTGAAAATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcg
aaaaactcaaaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTA
GAACGTTCGAAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACAC
GAACAAGGACTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaa
tataCACAGAATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAA
AGGCGGTCTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaa
attaatagaaaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaag
attcACAAATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACT
ATCACGTCCTTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTC
GATGGTAATGGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAA
AAGTTCGCCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGAC
TCTTTACAAGAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAA
AGACACGATTTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAA
ATAAGGATCAAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACAT
AAAATTCGTATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGT
AACAGCGAGCCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGC
CAATTTATCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAG
ACCTATTTAGCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATC
GACAGGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAA
GCCCTCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCC
GCCATTTTGGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATC
AAACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGT
CATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTT
GATCGTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGA
TATGTATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACA
TGCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGAC
GTCGCTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGA
CGACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCAT
CTTCGCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAA
TCAAATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATC
AACGAGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGC
TGGATGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCA
CATGAGAAATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATC
AGGGTTAGAACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCA
TTCGAAACACTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACT
GGGTCCTTCGATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACAC
CATCATATCGCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTA
ATGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCA
ACATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTA
TGTTCCAGATAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACAT
CAACGTCACAAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCC
ACTTCGGCCAACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCC
TTTTCGTCGACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAA
ATATTGGGTCATGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGAC
ATTTGTAGGGATTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAAC
CTGCTTCAAAGATATCATTGAACACACAAAAGGTTTGACTCATGAAGAAT
CCGAGACGTTTATAAAGCAATGTATGGATGAAACTGACAATGATGATGAT
TGTTTTGAAACTCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAG
AAATATCATAACATCAACATCAACAATTGTTGCTGAAAATGAACAGCCAT
GTTTTCAAGAACCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAA
TTTTCTCAAGGAAGAAGCTCTaaagAAAATTCATTAGATGTAGATgtcaa
tgacgtcatgaaaGGACGGCCCGTCGATTCTGAGAACGAGGCAGACGACC
CGCTGACAGAAAATGAAGGAATGAACACTCCACTACTCACTAGAAGGAAA
AGGCATTCATCAGGGTATCCGTTCGAACATATGGATAGTCACGAAAACAC
GGAGGATGGCACGACCACACCAAATCGTATCTCCTCCAAATCGAGATCCA
GATCACGCACGAAAGGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCG
ATGATGTTGTCATCAAATTCATCTTTGTGTAGTTACACTAGTGAACTCAC
TGATGgTTACTCCGATTACGATTACGACGTTCGCTCCATTACCGACGACA
CTGACGATTACGCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACTT
ATCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCG
GTCACGTATCATTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTACC
ACAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGC
GATATTGAAGGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAA
TATTCTGGCATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaa
tCCACGACTTGGAGCAACAAAACCAAACGTTGAAAGAAGAAATACAAGAC
ATTACGAACACACCCAACACTAACGAAGCACAACAAGAACTACTCATCAA
GGAATTGGAACGAGCACGTAAATGGATCGATAAACTCGAAGAGGAGAATC
GAGCTgttgaagaaagaaaaaggttGGCAGAGGATTTACAGAAAAACGAC
AAAGAATTGATTGACATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGA
TTTAACGACAGAACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAAC
TACTCGACATGATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTC
AAAACAACCAAAGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGA
TAGGCACATTGAAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAA
AACAAGAACTTGAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAA
GTCGAAAAGAAAGTATCTGTTCTGCAACACGAGGTTATACACTGTAACAA
ACAGATCGCTGACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAAC
GTCTTACAGATCTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCG
GGCAACGGTGGCACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACA
ATTCTTTATAAATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTC
TTAAAGAACTTGAACtggaaaatgataattatttaaaagaaattaaagGC
GTTTATGATAATTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGA
ACAGATAAAGGATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaaca
aaaatgcgGAAAAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGT
GAAAAAGAGAAACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAA
ATTGTCGCAGTATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCG
CGGCACGCATTGCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCA
AGTGACGATTCTGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGA
AGCAAGGTTATCGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAG
TGATCAATTTGGAACGAAAGCTTATGGATAAAGAACAAGAGATCTTACGT
CTAAACGATTCCATGGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGA
TCGATTCGACGCATTAGAACGTGAAAACATCATGTTACAGACTAAGCTGG
ACGAACTATCCCTTGAAAATGCTGAACAAAAGGATATGGTGAATAAACTG
AAAGAAGGAAATACACACTTAGAGAAAACGATACAGAATTTGAACACGAA
GTTAGATTCGTGTACGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATA
AATTGGGCAGGGAAGCATTGAAAAGAAATGAATCTATTAGTTGTGCACAT
GATGAAGTGACGTCGAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCT
ACAGGACAAATTGAAGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAAT
TAGAACAACAAGTGAAAATGGAACAATCCTATGTCCAATGGTATTTCGAC
GAAAAcgaaaaactcaaaatacaaACAGCCAAAATGGCGGACACTATTCG
GACATTAGAACGTTCGAAATTCGAATTCGAACAAAGCGTCCGTGAATTAT
CGGACACGAACAAGGACTTGAATAACGACGTGAAACGTTTAgaacaaaaa
cttgaaatataCACAGAATTATTCGATAAAGACTCTAATTTTCATACCTC
CCTCAAAAGGCGGTCTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAG
AcgaaaaattaatagaaaacGCCCTGGCACCATTAAtggaagaaatcaaa
gaaaaagattcACAAATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGA
CGTTACTATCACGTCCTTAAACAAAGAAATTGATACACTAGAAACGAATT
TAGCCTCGATGGTAATGGAGAAAATACGTGGTATGCAAATCCCCGACGAT
GCCGAAAAAGTTCGCCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTC
TACCGACTCTTTACAAGAACTTAAACAAGCTTATAAACTTTCTACTCAAA
ACGATAAAGACACGATTTTATCAAATCAGCACACAGATGGAGAACACGAT
AAACTAAATAAGGATCAAAAGACACTTCATAGACTCTCCTTCTTTGATGA
TTCACATAAAATTCGTATCGGAGAACCATGTACTTTATTACTTTCAACTA
CTGATGTAACAGCGAGCCATGATCATTCAACGAAGGGACCTCAAGTCTCA
CCGACGCCAATTTATCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATC
CAAAGAGACCTATTTAGCACTAACATCAAAAACAGTGAATAGCCCGAAAG
AGGAATCGACAGGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAAT
CCAACAAGCCCTCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAAT
AGAATCCGCCATTTTGGACCAATACCGAGGTGACGATCAACATTGTTACC
TGAAATCAAACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCC
TACACGTCATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAG
CGATGTTGATCGTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAG
TGGATGATATGTATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAG
AAAAACATGCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAAC
TAGAGACGTCGCTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGT
CAAACGACGACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCAC
AAAGCATCTTCGCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAG
TCGAGAATCAAATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTA
CGCCATCAACGAGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTA
TCGGGGCTGGATGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTC
GCATGCACATGAGAAATATGCCAGTGTTGttcagGAAAGCAAACGTCGTT
CGGTATCAGGGTTAGAACACAAACCGGTGTTATCGAAAACCATGCCCGTC
CCTTCCATTCGAAACACTCGTAGACGAATCATCAAAGTTAGCGGATTAAA
TCGAACTGGGTCCTTCGATAGCACTCGAGTTAAACCGAAAATCTTATCTT
CAAACACCATCATATCGCACAGTTCATCTAGCCTACCATCCACTACTAAA
CATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAA
CACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCG
TTATTTATGTTCCAGATAAAGACGGAAACGTCTCCATTCCTCCTACAACT
GGTACATCAACGTCACAAGATAAACCACAGACTACGTCTGCTACGGGTCC
GGCTCCCACTTCGGCCAACGACCCAACGTCTTCGATTTCGGCGACTAGTA
ACCCGCCTTTTCGTCGACCGTCACTCAAACAAAGTCgctttttgacttca
aattcAAATATTGGGTCATGAATGGcacaagaaaatgatgaaagtTTTGT
CAAGGACATTTGTAGGGATTTTATACCACAGAAATGGCGAAAAACAAAAT
GCCAAACCTGCTTCAAAGATATCATTGAACACACAAAAGGTTTGACTCAT
GAAGAATCCGAGACGTTTATAAAGCAATGTATGGATGAAACTGACAATGA
TGATGATTGTTTTGAAACTCAAACAGAAGAAACATTCAGAAAAATATCTA
GAGGAAGAAATATCATAACATCAACATCAACAATTGTTGCTGAAAATGAA
CAGCCATGTTTTCAAGAACCTCATTGTCATCAACATCATCATCAAAGGAG
AAGGCAATTTTCTCAAGGAAGAAGCTCTaaagAAAATTCATTAGATGTAG
ATgtcaatgacgtcatgaaaGGACGGCCCGTCGATTCTGAGAACGAGGCA
GACGACCCGCTGACAGAAAATGAAGGAATGAACACTCCACTACTCACTAG
AAGGAAAAGGCATTCATCAGGGTATCCGTTCGAACATATGGATAGTCACG
AAAACACGGAGGATGGCACGACCACACCAAATCGTATCTCCTCCAAATCG
AGATCCAGATCACGCACGAAAGGGAAAAGCCAATCGAATTTACTGTCTTT
GTCGGCGATGATGTTGTCATCAAATTCATCTTTGTGTAGTTACACTAGTG
AACTCACTGATGgTTACTCCGATTACGATTACGACGTTCGCTCCATTACC
GACGACACTGACGATTACGCCGATATTCCCGATGTTGTAATTGAGGAACT
GGAACTTATCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTG
TATCTCGGTCACGTATCATTAGCCTGGAGAGAGAATTAGAAGGTCAACAT
GATTACCACAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTT
ACAACGCGATATTGAAGGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTC
ATGAAAATATTCTGGCATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaac
agtagaatCCACGACTTGGAGCAACAAAACCAAACGTTGAAAGAAGAAAT
ACAAGACATTACGAACACACCCAACACTAACGAAGCACAACAAGAACTAC
TCATCAAGGAATTGGAACGAGCACGTAAATGGATCGATAAACTCGAAGAG
GAGAATCGAGCTgttgaagaaagaaaaaggttGGCAGAGGATTTACAGAA
AAACGACAAAGAATTGATTGACATCCTACGGAACCAGTGCGGGTCGCTGG
AAGAGGATTTAACGACAGAACAAGATCGTAACAGCCAACTAGAAGACAAA
CTGAAACTACTCGACATGATGCGATCTGACTTTCTCAAAGAACAAGAAAA
ACATGTCAAAACAACCAAAGAATTAGAATCGATGCGTCAAAAGATAAAAC
GCCGTGATAGGCACATTGAAGACTTAGAAGACGACAATGTGAAACTGCAA
CAACTAAAACAAGAACTTGAATCTAATATGGCTAAGAAAGAATTCAAGAT
CAAAAAAGTCGAAAAGAAAGTATCTGTTCTGCAACACGAGGTTATACACT
GTAACAAACAGATCGCTGACCTGACCGGCGAAAACAAGACTTTAGAACAG
GTCAAACGTCTTACAGATCTCAAATTAAAAGACATGTCTAGCATCGCGCA
ACAGTCGGGCAACGGTGGCACAAACAGTGGTACAACAGAGGTTGCTACTA
ACGAACAATTCTTTATAAATACACTCGAAGATCGTTTAAAACATCGCGAA
TCACGTCTTAAAGAACTTGAACtggaaaatgataattatttaaaagaaat
taaagGCGTTTATGATAATTTATTGGACGTCGAACGACAGCGAGAGGAAT
GTAAGGAACAGATAAAGGATAATGAAATCAGGTTATCTAAGCtacgaaaa
gaaaacaaaaatgcgGAAAAGAAGATTGAACTATTACATCGTAAATTACA
GAAAAGTGAAAAAGAGAAACGTAGAGCTTTGAATAAACAGACTCAAGCTG
AAATGAAATTGTCGCAGTATCACCAAGAACAGGAGTCAGTGGCCATGGCG
TTGAGCGCGGCACGCATTGCTGAAAATACAGCCGATCAACAGGCTACGTA
TGATTCAAGTGACGATTCTGATTCTAGAATTTTGAAGTTGAAATTACAAT
CGACTGAAGCAAGGTTATCGATGATTGAAGTCAATAAAGGATATCTAGAA
TCGAAAGTGATCAATTTGGAACGAAAGCTTATGGATAAAGAACAAGAGAT
CTTACGTCTAAACGATTCCATGGAACGCGATTCTGGAGCCCCGTCGCAAG
ACTATGATCGATTCGACGCATTAGAACGTGAAAACATCATGTTACAGACT
AAGCTGGACGAACTATCCCTTGAAAATGCTGAACAAAAGGATATGGTGAA
TAAACTGAAAGAAGGAAATACACACTTAGAGAAAACGATACAGAATTTGA
ACACGAAGTTAGATTCGTGTACGTTCCGACTTAAAGAACTTGAAGAAGCA
AACCATAAATTGGGCAGGGAAGCATTGAAAAGAAATGAATCTATTAGTTG
TGCACATGATGAAGTGACGTCGAGTTTGAACGAGCTCAAAGAGCATAACA
AAACTCTACAGGACAAATTGAAGCATTTCGAAAACGTCGAAGACCTCGTG
GAGCAATTAGAACAACAAGTGAAAATGGAACAATCCTATGTCCAATGGTA
TTTCGACGAAAAcgaaaaactcaaaatacaaACAGCCAAAATGGCGGACA
CTATTCGGACATTAGAACGTTCGAAATTCGAATTCGAACAAAGCGTCCGT
GAATTATCGGACACGAACAAGGACTTGAATAACGACGTGAAACGTTTAga
acaaaaacttgaaatataCACAGAATTATTCGATAAAGACTCTAATTTTC
ATACCTCCCTCAAAAGGCGGTCTTATCAGGGTGGTGAAAATAATCAAGAA
CAAGCAGAcgaaaaattaatagaaaacGCCCTGGCACCATTAAtggaaga
aatcaaagaaaaagattcACAAATACGAAATTTACAAAAGCTAGTCGAAG
AGAAAGACGTTACTATCACGTCCTTAAACAAAGAAATTGATACACTAGAA
ACGAATTTAGCCTCGATGGTAATGGAGAAAATACGTGGTATGCAAATCCC
CGACGATGCCGAAAAAGTTCGCCAAGAAAGTGCTGCATCACATAATGGGC
TTTTCTCTACCGACTCTTTACAAGAACTTAAACAAGCTTATAAACTTTCT
ACTCAAAACGATAAAGACACGATTTTATCAAATCAGCACACAGATGGAGA
ACACGATAAACTAAATAAGGATCAAAAGACACTTCATAGACTCTCCTTCT
TTGATGATTCACATAAAATTCGTATCGGAGAACCATGTACTTTATTACTT
TCAACTACTGATGTAACAGCGAGCCATGATCATTCAACGAAGGGACCTCA
AGTCTCACCGACGCCAATTTATCAAACGCCGACGTCATCGGGCCCTCAGT
CCCCATCCAAAGAGACCTATTTAGCACTAACATCAAAAACAGTGAATAGC
CCGAAAGAGGAATCGACAGGCCATTACGAACAATTATACTCTGGTTCAAG
CAGTAATCCAACAAGCCCTCGTTCCTCACGTCCCAGCTCCAACATTTACC
AAACAATAGAATCCGCCATTTTGGACCAATACCGAGGTGACGATCAACAT
TGTTACCTGAAATCAAACATCCCTCCTCTTGATAGTCGGCACGGTGAGAG
CCCGCCCTACACGTCATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAA
ACCGCAGCGATGTTGATCGTAAAAGTATTTCTAATATGGCCGAAAATAAG
GCTTTAGTGGATGATATGTATGACCAATTAGCCTTACTCGAGGATCTGGT
TTCGAAGAAAAACATGCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAA
CGAAAACTAGAGACGTCGCTAAACCCGTTAAAGTCTCGACATCGGAAAAT
GATACGTCAAACGACGACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAG
CGGGCACAAAGCATCTTCGCACATCCGGATCCCGAAATTAAGTCAACGGC
AATCGAGTCGAGAATCAAATCTTGGTTTACCATCGAACACAAAGTTACTT
TGTCGTACGCCATCAACGAGTAGCTCGCATTCACAAGATAGCACCTGTAT
AGATTTATCGGGGCTGGATGATTTGTTAGCAGAAGTTGATGGCCACAGGG
GAGGCTCGCATGCACATGAGAAATATGCCAGTGTTGttcagGAAAGCAAA
CGTCGTTCGGTATCAGGGTTAGAACACAAACCGGTGTTATCGAAAACCAT
GCCCGTCCCTTCCATTCGAAACACTCGTAGACGAATCATCAAAGTTAGCG
GATTAAATCGAACTGGGTCCTTCGATAGCACTCGAGTTAAACCGAAAATC
TTATCTTCAAACACCATCATATCGCACAGTTCATCTAGCCTACCATCCAC
TACTAAACATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTG
ACAACAACACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTT
TCCagCGTTATTTATGTTCCAGATAAAGACGGAAACGTCTCCATTCCTCC
TACAACTGGTACATCAACGTCACAAGATAAACCACAGACTACGTCTGCTA
CGGGTCCGGCTCCCACTTCGGCCAACGACCCAACGTCTTCGATTTCGGCG
ACTAGTAACCCGCCTTTTCGTCGACCGTCACTCAAACAAAGTCgcttttt
gacttcaaattcAAATATTGGGTCATGAATGGcacaagaaaatgatgaaa
gtTTTGTCAAGGACATTTGTAGGGATTTTATACCACAGAAATGGCGAAAA
ACAAAATGCCAAACCTGCTTCAAAGATATCATTGAACACACAAAAGGTTT
GACTCATGAAGAATCCGAGACGTTTATAAAGCAATGTATGGATGAAACTG
ACAATGATGATGATTGTTTTGAAACTCAAACAGAAGAAACATTCAGAAAA
ATATCTAGAGGAAGAAATATCATAACATCAACATCAACAATTGTTGCTGA
AAATGAACAGCCATGTTTTCAAGAACCTCATTGTCATCAACATCATCATC
AAAGGAGAAGGCAATTTTCTCAAGGAAGAAGCTCTaaagAAAATTCATTA
GATGTAGATgtcaatgacgtcatgaaaGGACGGCCCGTCGATTCTGAGAA
CGAGGCAGACGACCCGCTGACAGAAAATGAAGGAATGAACACTCCACTAC
TCACTAGAAGGAAAAGGCATTCATCAGGGTATCCGTTCGAACATATGGAT
AGTCACGAAAACACGGAGGATGGCACGACCACACCAAATCGTATCTCCTC
CAAATCGAGATCCAGATCACGCACGAAAGGGAAAAGCCAATCGAATTTAC
TGTCTTTGTCGGCGATGATGTTGTCATCAAATTCATCTTTGTGTAGTTAC
ACTAGTGAACTCACTGATGgTTACTCCGATTACGATTACGACGTTCGCTC
CATTACCGACGACACTGACGATTACGCCGATATTCCCGATGTTGTAATTG
AGGAACTGGAACTTATCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAA
CGCCGTGTATCTCGGTCACGTATCATTAGCCTGGAGAGAGAATTAGAAGG
TCAACATGATTACCACAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGA
AGTCTTTACAACGCGATATTGAAGGTTTGAAGTTGGAATTATCAAGTGTG
AAAGCTCATGAAAATATTCTGGCATTGAAAAGCCGTTTAGAACTTGAAGg
taaaaacagtagaatCCACGACTTGGAGCAACAAAACCAAACGTTGAAAG
AAGAAATACAAGACATTACGAACACACCCAACACTAACGAAGCACAACAA
GAACTACTCATCAAGGAATTGGAACGAGCACGTAAATGGATCGATAAACT
CGAAGAGGAGAATCGAGCTgttgaagaaagaaaaaggttGGCAGAGGATT
TACAGAAAAACGACAAAGAATTGATTGACATCCTACGGAACCAGTGCGGG
TCGCTGGAAGAGGATTTAACGACAGAACAAGATCGTAACAGCCAACTAGA
AGACAAACTGAAACTACTCGACATGATGCGATCTGACTTTCTCAAAGAAC
AAGAAAAACATGTCAAAACAACCAAAGAATTAGAATCGATGCGTCAAAAG
ATAAAACGCCGTGATAGGCACATTGAAGACTTAGAAGACGACAATGTGAA
ACTGCAACAACTAAAACAAGAACTTGAATCTAATATGGCTAAGAAAGAAT
TCAAGATCAAAAAAGTCGAAAAGAAAGTATCTGTTCTGCAACACGAGGTT
ATACACTGTAACAAACAGATCGCTGACCTGACCGGCGAAAACAAGACTTT
AGAACAGGTCAAACGTCTTACAGATCTCAAATTAAAAGACATGTCTAGCA
TCGCGCAACAGTCGGGCAACGGTGGCACAAACAGTGGTACAACAGAGGTT
GCTACTAACGAACAATTCTTTATAAATACACTCGAAGATCGTTTAAAACA
TCGCGAATCACGTCTTAAAGAACTTGAACtggaaaatgataattatttaa
aagaaattaaagGCGTTTATGATAATTTATTGGACGTCGAACGACAGCGA
GAGGAATGTAAGGAACAGATAAAGGATAATGAAATCAGGTTATCTAAGCt
acgaaaagaaaacaaaaatgcgGAAAAGAAGATTGAACTATTACATCGTA
AATTACAGAAAAGTGAAAAAGAGAAACGTAGAGCTTTGAATAAACAGACT
CAAGCTGAAATGAAATTGTCGCAGTATCACCAAGAACAGGAGTCAGTGGC
CATGGCGTTGAGCGCGGCACGCATTGCTGAAAATACAGCCGATCAACAGG
CTACGTATGATTCAAGTGACGATTCTGATTCTAGAATTTTGAAGTTGAAA
TTACAATCGACTGAAGCAAGGTTATCGATGATTGAAGTCAATAAAGGATA
TCTAGAATCGAAAGTGATCAATTTGGAACGAAAGCTTATGGATAAAGAAC
AAGAGATCTTACGTCTAAACGATTCCATGGAACGCGATTCTGGAGCCCCG
TCGCAAGACTATGATCGATTCGACGCATTAGAACGTGAAAACATCATGTT
ACAGACTAAGCTGGACGAACTATCCCTTGAAAATGCTGAACAAAAGGATA
TGGTGAATAAACTGAAAGAAGGAAATACACACTTAGAGAAAACGATACAG
AATTTGAACACGAAGTTAGATTCGTGTACGTTCCGACTTAAAGAACTTGA
AGAAGCAAACCATAAATTGGGCAGGGAAGCATTGAAAAGAAATGAATCTA
TTAGTTGTGCACATGATGAAGTGACGTCGAGTTTGAACGAGCTCAAAGAG
CATAACAAAACTCTACAGGACAAATTGAAGCATTTCGAAAACGTCGAAGA
CCTCGTGGAGCAATTAGAACAACAAGTGAAAATGGAACAATCCTATGTCC
AATGGTATTTCGACGAAAAcgaaaaactcaaaatacaaACAGCCAAAATG
GCGGACACTATTCGGACATTAGAACGTTCGAAATTCGAATTCGAACAAAG
CGTCCGTGAATTATCGGACACGAACAAGGACTTGAATAACGACGTGAAAC
GTTTAgaacaaaaacttgaaatataCACAGAATTATTCGATAAAGACTCT
AATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAGGGTGGTGAAAATAA
TCAAGAACAAGCAGAcgaaaaattaatagaaaacGCCCTGGCACCATTAA
tggaagaaatcaaagaaaaagattcACAAATACGAAATTTACAAAAGCTA
GTCGAAGAGAAAGACGTTACTATCACGTCCTTAAACAAAGAAATTGATAC
ACTAGAAACGAATTTAGCCTCGATGGTAATGGAGAAAATACGTGGTATGC
AAATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAAGTGCTGCATCACAT
AATGGGCTTTTCTCTACCGACTCTTTACAAGAACTTAAACAAGCTTATAA
ACTTTCTACTCAAAACGATAAAGACACGATTTTATCAAATCAGCACACAG
ATGGAGAACACGATAAACTAAATAAGGATCAAAAGACACTTCATAGACTC
TCCTTCTTTGATGATTCACATAAAATTCGTATCGGAGAACCATGTACTTT
ATTACTTTCAACTACTGATGTAACAGCGAGCCATGATCATTCAACGAAGG
GACCTCAAGTCTCACCGACGCCAATTTATCAAACGCCGACGTCATCGGGC
CCTCAGTCCCCATCCAAAGAGACCTATTTAGCACTAACATCAAAAACAGT
GAATAGCCCGAAAGAGGAATCGACAGGCCATTACGAACAATTATACTCTG
GTTCAAGCAGTAATCCAACAAGCCCTCGTTCCTCACGTCCCAGCTCCAAC
ATTTACCAAACAATAGAATCCGCCATTTTGGACCAATACCGAGGTGACGA
TCAACATTGTTACCTGAAATCAAACATCCCTCCTCTTGATAGTCGGCACG
GTGAGAGCCCGCCCTACACGTCATATATTGAATCAGCGGCCGCCGGGCTG
GGTCTAAACCGCAGCGATGTTGATCGTAAAAGTATTTCTAATATGGCCGA
AAATAAGGCTTTAGTGGATGATATGTATGACCAATTAGCCTTACTCGAGG
ATCTGGTTTCGAAGAAAAACATGCCTCCACCGTTAAGTCCGTCTGCCGTG
TCTCCAACGAAAACTAGAGACGTCGCTAAACCCGTTAAAGTCTCGACATC
GGAAAATGATACGTCAAACGACGACTCTTCGCAACCGGCTTCCCCGAATA
AAGAGAGCGGGCACAAAGCATCTTCGCACATCCGGATCCCGAAATTAAGT
CAACGGCAATCGAGTCGAGAATCAAATCTTGGTTTACCATCGAACACAAA
GTTACTTTGTCGTACGCCATCAACGAGTAGCTCGCATTCACAAGATAGCA
CCTGTATAGATTTATCGGGGCTGGATGATTTGTTAGCAGAAGTTGATGGC
CACAGGGGAGGCTCGCATGCACATGAGAAATATGCCAGTGTTGttcagGA
AAGCAAACGTCGTTCGGTATCAGGGTTAGAACACAAACCGGTGTTATCGA
AAACCATGCCCGTCCCTTCCATTCGAAACACTCGTAGACGAATCATCAAA
GTTAGCGGATTAAATCGAACTGGGTCCTTCGATAGCACTCGAGTTAAACC
GAAAATCTTATCTTCAAACACCATCATATCGCACAGTTCATCTAGCCTAC
CATCCACTACTAAACATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGT
CTCCTTGACAACAACACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTC
AAGCGTTTCCagCGTTATTTATGTTCCAGATAAAGACGGAAACGTCTCCA
TTCCTCCTACAACTGGTACATCAACGTCACAAGATAAACCACAGACTACG
TCTGCTACGGGTCCGGCTCCCACTTCGGCCAACGACCCAACGTCTTCGAT
TTCGGCGACTAGTAACCCGCCTTTTCGTCGACCGTCACTCAAACAAAGTC
gctttttgacttcaaattcAAATATTGGGTCATGAATGGcacaagaaaat
gatgaaagtTTTGTCAAGGACATTTGTAGGGATTTTATACCACAGAAATG
GCGAAAAACAAAATGCCAAACCTGCTTCAAAGATATCATTGAACACACAA
AAGGTTTGACTCATGAAGAATCCGAGACGTTTATAAAGCAATGTATGGAT
GAAACTGACAATGATGATGATTGTTTTGAAACTCAAACAGAAGAAACATT
CAGAAAAATATCTAGAGGAAGAAATATCATAACATCAACATCAACAATTG
TTGCTGAAAATGAACAGCCATGTTTTCAAGAACCTCATTGTCATCAACAT
CATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAGAAGCTCTaaagAAAA
TTCATTAGATGTAGATgtcaatgacgtcatgaaaGGACGGCCCGTCGATT
CTGAGAACGAGGCAGACGACCCGCTGACAGAAAATGAAGGAATGAACACT
CCACTACTCACTAGAAGGAAAAGGCATTCATCAGGGTATCCGTTCGAACA
TATGGATAGTCACGAAAACACGGAGGATGGCACGACCACACCAAATCGTA
TCTCCTCCAAATCGAGATCCAGATCACGCACGAAAGGGAAAAGCCAATCG
AATTTACTGTCTTTGTCGGCGATGATGTTGTCATCAAATTCATCTTTGTG
TAGTTACACTAGTGAACTCACTGATGgTTACTCCGATTACGATTACGACG
TTCGCTCCATTACCGACGACACTGACGATTACGCCGATATTCCCGATGTT
GTAATTGAGGAACTGGAACTTATCAAACCCGAGCTTAAAGCGCGCGTTGA
AAACGAACGCCGTGTATCTCGGTCACGTATCATTAGCCTGGAGAGAGAAT
TAGAAGGTCAACATGATTACCACAGAGCCAGTGAAGTTGCGAGAGATCGA
CAGTTGAAGTCTTTACAACGCGATATTGAAGGTTTGAAGTTGGAATTATC
AAGTGTGAAAGCTCATGAAAATATTCTGGCATTGAAAAGCCGTTTAGAAC
TTGAAGgtaaaaacagtagaatCCACGACTTGGAGCAACAAAACCAAACG
TTGAAAGAAGAAATACAAGACATTACGAACACACCCAACACTAACGAAGC
ACAACAAGAACTACTCATCAAGGAATTGGAACGAGCACGTAAATGGATCG
ATAAACTCGAAGAGGAGAATCGAGCTgttgaagaaagaaaaaggttGGCA
GAGGATTTACAGAAAAACGACAAAGAATTGATTGACATCCTACGGAACCA
GTGCGGGTCGCTGGAAGAGGATTTAACGACAGAACAAGATCGTAACAGCC
AACTAGAAGACAAACTGAAACTACTCGACATGATGCGATCTGACTTTCTC
AAAGAACAAGAAAAACATGTCAAAACAACCAAAGAATTAGAATCGATGCG
TCAAAAGATAAAACGCCGTGATAGGCACATTGAAGACTTAGAAGACGACA
ATGTGAAACTGCAACAACTAAAACAAGAACTTGAATCTAATATGGCTAAG
AAAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGTATCTGTTCTGCAACA
CGAGGTTATACACTGTAACAAACAGATCGCTGACCTGACCGGCGAAAACA
AGACTTTAGAACAGGTCAAACGTCTTACAGATCTCAAATTAAAAGACATG
TCTAGCATCGCGCAACAGTCGGGCAACGGTGGCACAAACAGTGGTACAAC
AGAGGTTGCTACTAACGAACAATTCTTTATAAATACACTCGAAGATCGTT
TAAAACATCGCGAATCACGTCTTAAAGAACTTGAACtggaaaatgataat
tatttaaaagaaattaaagGCGTTTATGATAATTTATTGGACGTCGAACG
ACAGCGAGAGGAATGTAAGGAACAGATAAAGGATAATGAAATCAGGTTAT
CTAAGCtacgaaaagaaaacaaaaatgcgGAAAAGAAGATTGAACTATTA
CATCGTAAATTACAGAAAAGTGAAAAAGAGAAACGTAGAGCTTTGAATAA
ACAGACTCAAGCTGAAATGAAATTGTCGCAGTATCACCAAGAACAGGAGT
CAGTGGCCATGGCGTTGAGCGCGGCACGCATTGCTGAAAATACAGCCGAT
CAACAGGCTACGTATGATTCAAGTGACGATTCTGATTCTAGAATTTTGAA
GTTGAAATTACAATCGACTGAAGCAAGGTTATCGATGATTGAAGTCAATA
AAGGATATCTAGAATCGAAAGTGATCAATTTGGAACGAAAGCTTATGGAT
AAAGAACAAGAGATCTTACGTCTAAACGATTCCATGGAACGCGATTCTGG
AGCCCCGTCGCAAGACTATGATCGATTCGACGCATTAGAACGTGAAAACA
TCATGTTACAGACTAAGCTGGACGAACTATCCCTTGAAAATGCTGAACAA
AAGGATATGGTGAATAAACTGAAAGAAGGAAATACACACTTAGAGAAAAC
GATACAGAATTTGAACACGAAGTTAGATTCGTGTACGTTCCGACTTAAAG
AACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAGCATTGAAAAGAAAT
GAATCTATTAGTTGTGCACATGATGAAGTGACGTCGAGTTTGAACGAGCT
CAAAGAGCATAACAAAACTCTACAGGACAAATTGAAGCATTTCGAAAACG
TCGAAGACCTCGTGGAGCAATTAGAACAACAAGTGAAAATGGAACAATCC
TATGTCCAATGGTATTTCGACGAAAAcgaaaaactcaaaatacaaACAGC
CAAAATGGCGGACACTATTCGGACATTAGAACGTTCGAAATTCGAATTCG
AACAAAGCGTCCGTGAATTATCGGACACGAACAAGGACTTGAATAACGAC
GTGAAACGTTTAgaacaaaaacttgaaatataCACAGAATTATTCGATAA
AGACTCTAATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAGGGTGGTG
AAAATAATCAAGAACAAGCAGAcgaaaaattaatagaaaacGCCCTGGCA
CCATTAAtggaagaaatcaaagaaaaagattcACAAATACGAAATTTACA
AAAGCTAGTCGAAGAGAAAGACGTTACTATCACGTCCTTAAACAAAGAAA
TTGATACACTAGAAACGAATTTAGCCTCGATGGTAATGGAGAAAATACGT
GGTATGCAAATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAAGTGCTGC
ATCACATAATGGGCTTTTCTCTACCGACTCTTTACAAGAACTTAAACAAG
CTTATAAACTTTCTACTCAAAACGATAAAGACACGATTTTATCAAATCAG
CACACAGATGGAGAACACGATAAACTAAATAAGGATCAAAAGACACTTCA
TAGACTCTCCTTCTTTGATGATTCACATAAAATTCGTATCGGAGAACCAT
GTACTTTATTACTTTCAACTACTGATGTAACAGCGAGCCATGATCATTCA
ACGAAGGGACCTCAAGTCTCACCGACGCCAATTTATCAAACGCCGACGTC
ATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTTAGCACTAACATCAA
AAACAGTGAATAGCCCGAAAGAGGAATCGACAGGCCATTACGAACAATTA
TACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCGTTCCTCACGTCCCAG
CTCCAACATTTACCAAACAATAGAATCCGCCATTTTGGACCAATACCGAG
GTGACGATCAACATTGTTACCTGAAATCAAACATCCCTCCTCTTGATAGT
CGGCACGGTGAGAGCCCGCCCTACACGTCATATATTGAATCAGCGGCCGC
CGGGCTGGGTCTAAACCGCAGCGATGTTGATCGTAAAAGTATTTCTAATA
TGGCCGAAAATAAGGCTTTAGTGGATGATATGTATGACCAATTAGCCTTA
CTCGAGGATCTGGTTTCGAAGAAAAACATGCCTCCACCGTTAAGTCCGTC
TGCCGTGTCTCCAACGAAAACTAGAGACGTCGCTAAACCCGTTAAAGTCT
CGACATCGGAAAATGATACGTCAAACGACGACTCTTCGCAACCGGCTTCC
CCGAATAAAGAGAGCGGGCACAAAGCATCTTCGCACATCCGGATCCCGAA
ATTAAGTCAACGGCAATCGAGTCGAGAATCAAATCTTGGTTTACCATCGA
ACACAAAGTTACTTTGTCGTACGCCATCAACGAGTAGCTCGCATTCACAA
GATAGCACCTGTATAGATTTATCGGGGCTGGATGATTTGTTAGCAGAAGT
TGATGGCCACAGGGGAGGCTCGCATGCACATGAGAAATATGCCAGTGTTG
ttcagGAAAGCAAACGTCGTTCGGTATCAGGGTTAGAACACAAACCGGTG
TTATCGAAAACCATGCCCGTCCCTTCCATTCGAAACACTCGTAGACGAAT
CATCAAAGTTAGCGGATTAAATCGAACTGGGTCCTTCGATAGCACTCGAG
TTAAACCGAAAATCTTATCTTCAAACACCATCATATCGCACAGTTCATCT
AGCCTACCATCCACTACTAAACATCGTAATGTGAACGTAGAAATCCCGGC
TAGTCGTCTCCTTGACAACAACACGTCAACATCCTCTTTAGCAACCTCCT
CTTCTTCAAGCGTTTCCagCGTTATTTATGTTCCAGATAAAGACGGAAAC
GTCTCCATTCCTCCTACAACTGGTACATCAACGTCACAAGATAAACCACA
GACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGCCAACGACCCAACGT
CTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTCGACCGTCACTCAAA
CAAAGTCgctttttgacttcaaattcAAATATTGGGTCATGAATGGcaca
agaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGATTTTATACCAC
AGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAGATATCATTGAA
CACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTTATAAAGCAATG
TATGGATGAAACTGACAATGATGATGATTGTTTTGAAACTCAAACAGAAG
AAACATTCAGAAAAATATCTAGAGGAAGAAATATCATAACATCAACATCA
ACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAACCTCATTGTCA
TCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAGAAGCTCTa
aagAAAATTCATTAGATGTAGATgtcaatgacgtcatgaaaGGACGGCCC
GTCGATTCTGAGAACGAGGCAGACGACCCGCTGACAGAAAATGAAGGAAT
GAACACTCCACTACTCACTAGAAGGAAAAGGCATTCATCAGGGTATCCGT
TCGAACATATGGATAGTCACGAAAACACGGAGGATGGCACGACCACACCA
AATCGTATCTCCTCCAAATCGAGATCCAGATCACGCACGAAAGGGAAAAG
CCAATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTCATCAAATTCAT
CTTTGTGTAGTTACACTAGTGAACTCACTGATGgTTACTCCGATTACGAT
TACGACGTTCGCTCCATTACCGACGACACTGACGATTACGCCGATATTCC
CGATGTTGTAATTGAGGAACTGGAACTTATCAAACCCGAGCTTAAAGCGC
GCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTATCATTAGCCTGGAG
AGAGAATTAGAAGGTCAACATGATTACCACAGAGCCAGTGAAGTTGCGAG
AGATCGACAGTTGAAGTCTTTACAACGCGATATTGAAGGTTTGAAGTTGG
AATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCATTGAAAAGCCGT
TTAGAACTTGAAGgtaaaaacagtagaatCCACGACTTGGAGCAACAAAA
CCAAACGTTGAAAGAAGAAATACAAGACATTACGAACACACCCAACACTA
ACGAAGCACAACAAGAACTACTCATCAAGGAATTGGAACGAGCACGTAAA
TGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaagaaagaaaaag
gttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGATTGACATCCTAC
GGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGACAGAACAAGATCGT
AACAGCCAACTAGAAGACAAACTGAAACTACTCGACATGATGCGATCTGA
CTTTCTCAAAGAACAAGAAAAACATGTCAAAACAACCAAAGAATTAGAAT
CGATGCGTCAAAAGATAAAACGCCGTGATAGGCACATTGAAGACTTAGAA
GACGACAATGTGAAACTGCAACAACTAAAACAAGAACTTGAATCTAATAT
GGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGTATCTGTTC
TGCAACACGAGGTTATACACTGTAACAAACAGATCGCTGACCTGACCGGC
GAAAACAAGACTTTAGAACAGGTCAAACGTCTTACAGATCTCAAATTAAA
AGACATGTCTAGCATCGCGCAACAGTCGGGCAACGGTGGCACAAACAGTG
GTACAACAGAGGTTGCTACTAACGAACAATTCTTTATAAATACACTCGAA
GATCGTTTAAAACATCGCGAATCACGTCTTAAAGAACTTGAACtggaaaa
tgataattatttaaaagaaattaaagGCGTTTATGATAATTTATTGGACG
TCGAACGACAGCGAGAGGAATGTAAGGAACAGATAAAGGATAATGAAATC
AGGTTATCTAAGCtacgaaaagaaaacaaaaatgcgGAAAAGAAGATTGA
ACTATTACATCGTAAATTACAGAAAAGTGAAAAAGAGAAACGTAGAGCTT
TGAATAAACAGACTCAAGCTGAAATGAAATTGTCGCAGTATCACCAAGAA
CAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCATTGCTGAAAATAC
AGCCGATCAACAGGCTACGTATGATTCAAGTGACGATTCTGATTCTAGAA
TTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTTATCGATGATTGAA
GTCAATAAAGGATATCTAGAATCGAAAGTGATCAATTTGGAACGAAAGCT
TATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTCCATGGAACGCG
ATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACGCATTAGAACGT
GAAAACATCATGTTACAGACTAAGCTGGACGAACTATCCCTTGAAAATGC
TGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAATACACACTTAG
AGAAAACGATACAGAATTTGAACACGAAGTTAGATTCGTGTACGTTCCGA
CTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAGCATTGAA
AAGAAATGAATCTATTAGTTGTGCACATGATGAAGTGACGTCGAGTTTGA
ACGAGCTCAAAGAGCATAACAAAACTCTACAGGACAAATTGAAGCATTTC
GAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAAGTGAAAATGGA
ACAATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaaactcaaaatac
aaACAGCCAAAATGGCGGACACTATTCGGACATTAGAACGTTCGAAATTC
GAATTCGAACAAAGCGTCCGTGAATTATCGGACACGAACAAGGACTTGAA
TAACGACGTGAAACGTTTAgaacaaaaacttgaaatataCACAGAATTAT
TCGATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAG
GGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaattaatagaaaacGC
CCTGGCACCATTAAtggaagaaatcaaagaaaaagattcACAAATACGAA
ATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCACGTCCTTAAAC
AAAGAAATTGATACACTAGAAACGAATTTAGCCTCGATGGTAATGGAGAA
AATACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAA
GTGCTGCATCACATAATGGGCTTTTCTCTACCGACTCTTTACAAGAACTT
AAACAAGCTTATAAACTTTCTACTCAAAACGATAAAGACACGATTTTATC
AAATCAGCACACAGATGGAGAACACGATAAACTAAATAAGGATCAAAAGA
CACTTCATAGACTCTCCTTCTTTGATGATTCACATAAAATTCGTATCGGA
GAACCATGTACTTTATTACTTTCAACTACTGATGTAACAGCGAGCCATGA
TCATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAATTTATCAAACGC
CGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTTAGCACTA
ACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGACAGGCCATTACGA
ACAATTATACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCGTTCCTCAC
GTCCCAGCTCCAACATTTACCAAACAATAGAATCCGCCATTTTGGACCAA
TACCGAGGTGACGATCAACATTGTTACCTGAAATCAAACATCCCTCCTCT
TGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCATATATTGAATCAG
CGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGATCGTAAAAGTATT
TCTAATATGGCCGAAAATAAGGCTTTAGTGGATGATATGTATGACCAATT
AGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATGCCTCCACCGTTAA
GTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGTCGCTAAACCCGTT
AAAGTCTCGACATCGGAAAATGATACGTCAAACGACGACTCTTCGCAACC
GGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCTTCGCACATCCGGA
TCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATCAAATCTTGGTTTA
CCATCGAACACAAAGTTACTTTGTCGTACGCCATCAACGAGTAGCTCGCA
TTCACAAGATAGCACCTGTATAGATTTATCGGGGCTGGATGATTTGTTAG
CAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACATGAGAAATATGCC
AGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAGGGTTAGAACACAA
ACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATTCGAAACACTCGTA
GACGAATCATCAAAGTTAGCGGATTAAATCGAACTGGGTCCTTCGATAGC
ACTCGAGTTAAACCGAAAATCTTATCTTCAAACACCATCATATCGCACAG
TTCATCTAGCCTACCATCCACTACTAAACATCGTAATGTGAACGTAGAAA
TCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAACATCCTCTTTAGCA
ACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATGTTCCAGATAAAGA
CGGAAACGTCTCCATTCCTCCTACAACTGGTACATCAACGTCACAAGATA
AACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGCCAACGAC
CCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTCGACCGTC
ACTCAAACAAAGTCgctttttgacttcaaattcAAATATTGGGTCATGAA
TGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGATTTT
ATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAGATAT
CATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTTATAA
AGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGAAACTCAA
ACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCATAACATC
AACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAACCTC
ATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAGA
AGCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtcatgaaaGG
ACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGACAGAAAATG
AAGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATTCATCAGGG
TATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGATGGCACGAC
CACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACGCACGAAAG
GGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTCATCA
AATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgTTACTCCGA
TTACGATTACGACGTTCGCTCCATTACCGACGACACTGACGATTACGCCG
ATATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAACCCGAGCTT
AAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTATCATTAG
CCTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGCCAGTGAAG
TTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTGAAGGTTTG
AAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCATTGAA
AAGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGACTTGGAGC
AACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGAACACACCC
AACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTGGAACGAGC
ACGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaagaaa
gaaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGATTGAC
ATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGACAGAACA
AGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGACATGATGC
GATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAACCAAAGAA
TTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCACATTGAAGA
CTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGAACTTGAAT
CTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGTA
TCTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATCGCTGACCT
GACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTACAGATCTCA
AATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACGGTGGCACA
AACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTTATAAATAC
ACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGAACTTGAAC
tggaaaatgataattatttaaaagaaattaaagGCGTTTATGATAATTTA
TTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATAAAGGATAA
TGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgcgGAAAAGA
AGATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAGAGAAACGT
AGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCGCAGTATCA
CCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCATTGCTG
AAAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACGATTCTGAT
TCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTTATCGAT
GATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAATTTGGAAC
GAAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTCCATG
GAACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACGCATT
AGAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTATCCCTTG
AAAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAATACA
CACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATTCGTGTAC
GTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAG
CATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGTGACGTCG
AGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGACAAATTGAA
GCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAAGTGA
AAATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaaactc
aaaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTAGAACGTTC
GAAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACACGAACAAGG
ACTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaatataCACA
GAATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGCGGTC
TTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaattaatag
aaaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaagattcACAA
ATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCACGTC
CTTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTCGATGGTAA
TGGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGTTCGC
CAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGACTCTTTACA
AGAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAAAGACACGA
TTTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAAATAAGGAT
CAAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACATAAAATTCG
TATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGTAACAGCGA
GCCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAATTTAT
CAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTT
AGCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGACAGGCC
ATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCGT
TCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCCGCCATTTT
GGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATCAAACATCC
CTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCATATATT
GAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGATCGTAA
AAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGATATGTATG
ACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATGCCTCCA
CCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGTCGCTAA
ACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGACGACTCTT
CGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCTTCGCAC
ATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATCAAATCT
TGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATCAACGAGTA
GCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGCTGGATGAT
TTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACATGAGAA
ATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAGGGTTAG
AACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATTCGAAAC
ACTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACTGGGTCCTT
CGATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACACCATCATAT
CGCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTAATGTGAAC
GTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAACATCCTC
TTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATGTTCCAG
ATAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATCAACGTCA
CAAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGC
CAACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTC
GACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAATATTGGG
TCATGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAG
GGATTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCA
AAGATATCATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACG
TTTATAAAGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGA
AACTCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCA
TAACATCAACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAA
GAACCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCA
AGGAAGAAGCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtca
tgaaaGGACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGACA
GAAAATGAAGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATTC
ATCAGGGTATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGATG
GCACGACCACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACGC
ACGAAAGGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGTT
GTCATCAAATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgTT
ACTCCGATTACGATTACGACGTTCGCTCCATTACCGACGACACTGACGAT
TACGCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAACC
CGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTA
TCATTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGCC
AGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTGA
AGGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGG
CATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGAC
TTGGAGCAACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGAA
CACACCCAACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTGG
AACGAGCACGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgtt
gaagaaagaaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAATT
GATTGACATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGA
CAGAACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGAC
ATGATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAAC
CAAAGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCACA
TTGAAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGAA
CTTGAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAA
GAAAGTATCTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATCG
CTGACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTACA
GATCTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACGG
TGGCACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTTA
TAAATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGAA
CTTGAACtggaaaatgataattatttaaaagaaattaaagGCGTTTATGA
TAATTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATAA
AGGATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgcg
GAAAAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAGA
GAAACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCGC
AGTATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGC
ATTGCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACGA
TTCTGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGT
TATCGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAAT
TTGGAACGAAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGA
TTCCATGGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCG
ACGCATTAGAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTA
TCCCTTGAAAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGG
AAATACACACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATT
CGTGTACGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGC
AGGGAAGCATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGT
GACGTCGAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGACA
AATTGAAGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAA
CAAGTGAAAATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcga
aaaactcaaaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTAG
AACGTTCGAAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACACG
AACAAGGACTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaat
ataCACAGAATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAAA
GGCGGTCTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaa
ttaatagaaaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaaga
ttcACAAATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTA
TCACGTCCTTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTCG
ATGGTAATGGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAAA
AGTTCGCCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGACT
CTTTACAAGAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAAA
GACACGATTTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAAA
TAAGGATCAAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACATA
AAATTCGTATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGTA
ACAGCGAGCCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGCC
AATTTATCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGA
CCTATTTAGCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCG
ACAGGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAAG
CCCTCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCCG
CCATTTTGGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATCA
AACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTC
ATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTG
ATCGTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGAT
ATGTATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACAT
GCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACG
TCGCTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGAC
GACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATC
TTCGCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAAT
CAAATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATCA
ACGAGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGCT
GGATGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCAC
ATGAGAAATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCA
GGGTTAGAACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCAT
TCGAAACACTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACTG
GGTCCTTCGATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACACC
ATCATATCGCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTAA
TGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAA
CATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTAT
GTTCCAGATAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATC
AACGTCACAAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCA
CTTCGGCCAACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCT
TTTCGTCGACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAA
TATTGGGTCATGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGACA
TTTGTAGGGATTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAACC
TGCTTCAAAGATATCATTGAACACACAAAAGGTTTGACTCATGAAGAATC
CGAGACGTTTATAAAGCAATGTATGGATGAAACTGACAATGATGATGATT
GTTTTGAAACTCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGA
AATATCATAACATCAACATCAACAATTGTTGCTGAAAATGAACAGCCATG
TTTTCAAGAACCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAAT
TTTCTCAAGGAAGAAGCTCTaaagAAAATTCATTAGATGTAGATgtcaat
gacgtcatgaaaGGACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCC
GCTGACAGAAAATGAAGGAATGAACACTCCACTACTCACTAGAAGGAAAA
GGCATTCATCAGGGTATCCGTTCGAACATATGGATAGTCACGAAAACACG
GAGGATGGCACGACCACACCAAATCGTATCTCCTCCAAATCGAGATCCAG
ATCACGCACGAAAGGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGA
TGATGTTGTCATCAAATTCATCTTTGTGTAGTTACACTAGTGAACTCACT
GATGgTTACTCCGATTACGATTACGACGTTCGCTCCATTACCGACGACAC
TGACGATTACGCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACTTA
TCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGG
TCACGTATCATTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTACCA
CAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCG
ATATTGAAGGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAAT
ATTCTGGCATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaat
CCACGACTTGGAGCAACAAAACCAAACGTTGAAAGAAGAAATACAAGACA
TTACGAACACACCCAACACTAACGAAGCACAACAAGAACTACTCATCAAG
GAATTGGAACGAGCACGTAAATGGATCGATAAACTCGAAGAGGAGAATCG
AGCTgttgaagaaagaaaaaggttGGCAGAGGATTTACAGAAAAACGACA
AAGAATTGATTGACATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGAT
TTAACGACAGAACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAACT
ACTCGACATGATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCA
AAACAACCAAAGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGAT
AGGCACATTGAAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAAA
ACAAGAACTTGAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAG
TCGAAAAGAAAGTATCTGTTCTGCAACACGAGGTTATACACTGTAACAAA
CAGATCGCTGACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACG
TCTTACAGATCTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGG
GCAACGGTGGCACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACAA
TTCTTTATAAATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTCT
TAAAGAACTTGAACtggaaaatgataattatttaaaagaaattaaagGCG
TTTATGATAATTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAA
CAGATAAAGGATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaa
aaatgcgGAAAAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGTG
AAAAAGAGAAACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAA
TTGTCGCAGTATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGC
GGCACGCATTGCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCAA
GTGACGATTCTGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAA
GCAAGGTTATCGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGT
GATCAATTTGGAACGAAAGCTTATGGATAAAGAACAAGAGATCTTACGTC
TAAACGATTCCATGGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGAT
CGATTCGACGCATTAGAACGTGAAAACATCATGTTACAGACTAAGCTGGA
CGAACTATCCCTTGAAAATGCTGAACAAAAGGATATGGTGAATAAACTGA
AAGAAGGAAATACACACTTAGAGAAAACGATACAGAATTTGAACACGAAG
TTAGATTCGTGTACGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAA
ATTGGGCAGGGAAGCATTGAAAAGAAATGAATCTATTAGTTGTGCACATG
ATGAAGTGACGTCGAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTA
CAGGACAAATTGAAGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATT
AGAACAACAAGTGAAAATGGAACAATCCTATGTCCAATGGTATTTCGACG
AAAAcgaaaaactcaaaatacaaACAGCCAAAATGGCGGACACTATTCGG
ACATTAGAACGTTCGAAATTCGAATTCGAACAAAGCGTCCGTGAATTATC
GGACACGAACAAGGACTTGAATAACGACGTGAAACGTTTAgaacaaaaac
ttgaaatataCACAGAATTATTCGATAAAGACTCTAATTTTCATACCTCC
CTCAAAAGGCGGTCTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGA
cgaaaaattaatagaaaacGCCCTGGCACCATTAAtggaagaaatcaaag
aaaaagattcACAAATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGAC
GTTACTATCACGTCCTTAAACAAAGAAATTGATACACTAGAAACGAATTT
AGCCTCGATGGTAATGGAGAAAATACGTGGTATGCAAATCCCCGACGATG
CCGAAAAAGTTCGCCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCT
ACCGACTCTTTACAAGAACTTAAACAAGCTTATAAACTTTCTACTCAAAA
CGATAAAGACACGATTTTATCAAATCAGCACACAGATGGAGAACACGATA
AACTAAATAAGGATCAAAAGACACTTCATAGACTCTCCTTCTTTGATGAT
TCACATAAAATTCGTATCGGAGAACCATGTACTTTATTACTTTCAACTAC
TGATGTAACAGCGAGCCATGATCATTCAACGAAGGGACCTCAAGTCTCAC
CGACGCCAATTTATCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCC
AAAGAGACCTATTTAGCACTAACATCAAAAACAGTGAATAGCCCGAAAGA
GGAATCGACAGGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAATC
CAACAAGCCCTCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAATA
GAATCCGCCATTTTGGACCAATACCGAGGTGACGATCAACATTGTTACCT
GAAATCAAACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCT
ACACGTCATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGC
GATGTTGATCGTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGT
GGATGATATGTATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGA
AAAACATGCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACT
AGAGACGTCGCTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGTC
AAACGACGACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACA
AAGCATCTTCGCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGT
CGAGAATCAAATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTAC
GCCATCAACGAGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTAT
CGGGGCTGGATGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCG
CATGCACATGAGAAATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTC
GGTATCAGGGTTAGAACACAAACCGGTGTTATCGAAAACCATGCCCGTCC
CTTCCATTCGAAACACTCGTAGACGAATCATCAAAGTTAGCGGATTAAAT
CGAACTGGGTCCTTCGATAGCACTCGAGTTAAACCGAAAATCTTATCTTC
AAACACCATCATATCGCACAGTTCATCTAGCCTACCATCCACTACTAAAC
ATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAAC
ACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGT
TATTTATGTTCCAGATAAAGACGGAAACGTCTCCATTCCTCCTACAACTG
GTACATCAACGTCACAAGATAAACCACAGACTACGTCTGCTACGGGTCCG
GCTCCCACTTCGGCCAACGACCCAACGTCTTCGATTTCGGCGACTAGTAA
CCCGCCTTTTCGTCGACCGTCACTCAAACAAAGTCgctttttgacttcaa
attcAAATATTGGGTCATGAATGGcacaagaaaatgatgaaagtTTTGTC
AAGGACATTTGTAGGGATTTTATACCACAGAAATGGCGAAAAACAAAATG
CCAAACCTGCTTCAAAGATATCATTGAACACACAAAAGGTTTGACTCATG
AAGAATCCGAGACGTTTATAAAGCAATGTATGGATGAAACTGACAATGAT
GATGATTGTTTTGAAACTCAAACAGAAGAAACATTCAGAAAAATATCTAG
AGGAAGAAATATCATAACATCAACATCAACAATTGTTGCTGAAAATGAAC
AGCCATGTTTTCAAGAACCTCATTGTCATCAACATCATCATCAAAGGAGA
AGGCAATTTTCTCAAGGAAGAAGCTCTaaagAAAATTCATTAGATGTAGA
TgtcaatgacgtcatgaaaGGACGGCCCGTCGATTCTGAGAACGAGGCAG
ACGACCCGCTGACAGAAAATGAAGGAATGAACACTCCACTACTCACTAGA
AGGAAAAGGCATTCATCAGGGTATCCGTTCGAACATATGGATAGTCACGA
AAACACGGAGGATGGCACGACCACACCAAATCGTATCTCCTCCAAATCGA
GATCCAGATCACGCACGAAAGGGAAAAGCCAATCGAATTTACTGTCTTTG
TCGGCGATGATGTTGTCATCAAATTCATCTTTGTGTAGTTACACTAGTGA
ACTCACTGATGgTTACTCCGATTACGATTACGACGTTCGCTCCATTACCG
ACGACACTGACGATTACGCCGATATTCCCGATGTTGTAATTGAGGAACTG
GAACTTATCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGT
ATCTCGGTCACGTATCATTAGCCTGGAGAGAGAATTAGAAGGTCAACATG
ATTACCACAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTA
CAACGCGATATTGAAGGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTCA
TGAAAATATTCTGGCATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaaca
gtagaatCCACGACTTGGAGCAACAAAACCAAACGTTGAAAGAAGAAATA
CAAGACATTACGAACACACCCAACACTAACGAAGCACAACAAGAACTACT
CATCAAGGAATTGGAACGAGCACGTAAATGGATCGATAAACTCGAAGAGG
AGAATCGAGCTgttgaagaaagaaaaaggttGGCAGAGGATTTACAGAAA
AACGACAAAGAATTGATTGACATCCTACGGAACCAGTGCGGGTCGCTGGA
AGAGGATTTAACGACAGAACAAGATCGTAACAGCCAACTAGAAGACAAAC
TGAAACTACTCGACATGATGCGATCTGACTTTCTCAAAGAACAAGAAAAA
CATGTCAAAACAACCAAAGAATTAGAATCGATGCGTCAAAAGATAAAACG
CCGTGATAGGCACATTGAAGACTTAGAAGACGACAATGTGAAACTGCAAC
AACTAAAACAAGAACTTGAATCTAATATGGCTAAGAAAGAATTCAAGATC
AAAAAAGTCGAAAAGAAAGTATCTGTTCTGCAACACGAGGTTATACACTG
TAACAAACAGATCGCTGACCTGACCGGCGAAAACAAGACTTTAGAACAGG
TCAAACGTCTTACAGATCTCAAATTAAAAGACATGTCTAGCATCGCGCAA
CAGTCGGGCAACGGTGGCACAAACAGTGGTACAACAGAGGTTGCTACTAA
CGAACAATTCTTTATAAATACACTCGAAGATCGTTTAAAACATCGCGAAT
CACGTCTTAAAGAACTTGAACtggaaaatgataattatttaaaagaaatt
aaagGCGTTTATGATAATTTATTGGACGTCGAACGACAGCGAGAGGAATG
TAAGGAACAGATAAAGGATAATGAAATCAGGTTATCTAAGCtacgaaaag
aaaacaaaaatgcgGAAAAGAAGATTGAACTATTACATCGTAAATTACAG
AAAAGTGAAAAAGAGAAACGTAGAGCTTTGAATAAACAGACTCAAGCTGA
AATGAAATTGTCGCAGTATCACCAAGAACAGGAGTCAGTGGCCATGGCGT
TGAGCGCGGCACGCATTGCTGAAAATACAGCCGATCAACAGGCTACGTAT
GATTCAAGTGACGATTCTGATTCTAGAATTTTGAAGTTGAAATTACAATC
GACTGAAGCAAGGTTATCGATGATTGAAGTCAATAAAGGATATCTAGAAT
CGAAAGTGATCAATTTGGAACGAAAGCTTATGGATAAAGAACAAGAGATC
TTACGTCTAAACGATTCCATGGAACGCGATTCTGGAGCCCCGTCGCAAGA
CTATGATCGATTCGACGCATTAGAACGTGAAAACATCATGTTACAGACTA
AGCTGGACGAACTATCCCTTGAAAATGCTGAACAAAAGGATATGGTGAAT
AAACTGAAAGAAGGAAATACACACTTAGAGAAAACGATACAGAATTTGAA
CACGAAGTTAGATTCGTGTACGTTCCGACTTAAAGAACTTGAAGAAGCAA
ACCATAAATTGGGCAGGGAAGCATTGAAAAGAAATGAATCTATTAGTTGT
GCACATGATGAAGTGACGTCGAGTTTGAACGAGCTCAAAGAGCATAACAA
AACTCTACAGGACAAATTGAAGCATTTCGAAAACGTCGAAGACCTCGTGG
AGCAATTAGAACAACAAGTGAAAATGGAACAATCCTATGTCCAATGGTAT
TTCGACGAAAAcgaaaaactcaaaatacaaACAGCCAAAATGGCGGACAC
TATTCGGACATTAGAACGTTCGAAATTCGAATTCGAACAAAGCGTCCGTG
AATTATCGGACACGAACAAGGACTTGAATAACGACGTGAAACGTTTAgaa
caaaaacttgaaatataCACAGAATTATTCGATAAAGACTCTAATTTTCA
TACCTCCCTCAAAAGGCGGTCTTATCAGGGTGGTGAAAATAATCAAGAAC
AAGCAGAcgaaaaattaatagaaaacGCCCTGGCACCATTAAtggaagaa
atcaaagaaaaagattcACAAATACGAAATTTACAAAAGCTAGTCGAAGA
GAAAGACGTTACTATCACGTCCTTAAACAAAGAAATTGATACACTAGAAA
CGAATTTAGCCTCGATGGTAATGGAGAAAATACGTGGTATGCAAATCCCC
GACGATGCCGAAAAAGTTCGCCAAGAAAGTGCTGCATCACATAATGGGCT
TTTCTCTACCGACTCTTTACAAGAACTTAAACAAGCTTATAAACTTTCTA
CTCAAAACGATAAAGACACGATTTTATCAAATCAGCACACAGATGGAGAA
CACGATAAACTAAATAAGGATCAAAAGACACTTCATAGACTCTCCTTCTT
TGATGATTCACATAAAATTCGTATCGGAGAACCATGTACTTTATTACTTT
CAACTACTGATGTAACAGCGAGCCATGATCATTCAACGAAGGGACCTCAA
GTCTCACCGACGCCAATTTATCAAACGCCGACGTCATCGGGCCCTCAGTC
CCCATCCAAAGAGACCTATTTAGCACTAACATCAAAAACAGTGAATAGCC
CGAAAGAGGAATCGACAGGCCATTACGAACAATTATACTCTGGTTCAAGC
AGTAATCCAACAAGCCCTCGTTCCTCACGTCCCAGCTCCAACATTTACCA
AACAATAGAATCCGCCATTTTGGACCAATACCGAGGTGACGATCAACATT
GTTACCTGAAATCAAACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGC
CCGCCCTACACGTCATATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAA
CCGCAGCGATGTTGATCGTAAAAGTATTTCTAATATGGCCGAAAATAAGG
CTTTAGTGGATGATATGTATGACCAATTAGCCTTACTCGAGGATCTGGTT
TCGAAGAAAAACATGCCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAAC
GAAAACTAGAGACGTCGCTAAACCCGTTAAAGTCTCGACATCGGAAAATG
ATACGTCAAACGACGACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGC
GGGCACAAAGCATCTTCGCACATCCGGATCCCGAAATTAAGTCAACGGCA
ATCGAGTCGAGAATCAAATCTTGGTTTACCATCGAACACAAAGTTACTTT
GTCGTACGCCATCAACGAGTAGCTCGCATTCACAAGATAGCACCTGTATA
GATTTATCGGGGCTGGATGATTTGTTAGCAGAAGTTGATGGCCACAGGGG
AGGCTCGCATGCACATGAGAAATATGCCAGTGTTGttcagGAAAGCAAAC
GTCGTTCGGTATCAGGGTTAGAACACAAACCGGTGTTATCGAAAACCATG
CCCGTCCCTTCCATTCGAAACACTCGTAGACGAATCATCAAAGTTAGCGG
ATTAAATCGAACTGGGTCCTTCGATAGCACTCGAGTTAAACCGAAAATCT
TATCTTCAAACACCATCATATCGCACAGTTCATCTAGCCTACCATCCACT
ACTAAACATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGA
CAACAACACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTT
CCagCGTTATTTATGTTCCAGATAAAGACGGAAACGTCTCCATTCCTCCT
ACAACTGGTACATCAACGTCACAAGATAAACCACAGACTACGTCTGCTAC
GGGTCCGGCTCCCACTTCGGCCAACGACCCAACGTCTTCGATTTCGGCGA
CTAGTAACCCGCCTTTTCGTCGACCGTCACTCAAACAAAGTCgctttttg
acttcaaattcAAATATTGGGTCATGAATGGcacaagaaaatgatgaaag
tTTTGTCAAGGACATTTGTAGGGATTTTATACCACAGAAATGGCGAAAAA
CAAAATGCCAAACCTGCTTCAAAGATATCATTGAACACACAAAAGGTTTG
ACTCATGAAGAATCCGAGACGTTTATAAAGCAATGTATGGATGAAACTGA
CAATGATGATGATTGTTTTGAAACTCAAACAGAAGAAACATTCAGAAAAA
TATCTAGAGGAAGAAATATCATAACATCAACATCAACAATTGTTGCTGAA
AATGAACAGCCATGTTTTCAAGAACCTCATTGTCATCAACATCATCATCA
AAGGAGAAGGCAATTTTCTCAAGGAAGAAGCTCTaaagAAAATTCATTAG
ATGTAGATgtcaatgacgtcatgaaaGGACGGCCCGTCGATTCTGAGAAC
GAGGCAGACGACCCGCTGACAGAAAATGAAGGAATGAACACTCCACTACT
CACTAGAAGGAAAAGGCATTCATCAGGGTATCCGTTCGAACATATGGATA
GTCACGAAAACACGGAGGATGGCACGACCACACCAAATCGTATCTCCTCC
AAATCGAGATCCAGATCACGCACGAAAGGGAAAAGCCAATCGAATTTACT
GTCTTTGTCGGCGATGATGTTGTCATCAAATTCATCTTTGTGTAGTTACA
CTAGTGAACTCACTGATGgTTACTCCGATTACGATTACGACGTTCGCTCC
ATTACCGACGACACTGACGATTACGCCGATATTCCCGATGTTGTAATTGA
GGAACTGGAACTTATCAAACCCGAGCTTAAAGCGCGCGTTGAAAACGAAC
GCCGTGTATCTCGGTCACGTATCATTAGCCTGGAGAGAGAATTAGAAGGT
CAACATGATTACCACAGAGCCAGTGAAGTTGCGAGAGATCGACAGTTGAA
GTCTTTACAACGCGATATTGAAGGTTTGAAGTTGGAATTATCAAGTGTGA
AAGCTCATGAAAATATTCTGGCATTGAAAAGCCGTTTAGAACTTGAAGgt
aaaaacagtagaatCCACGACTTGGAGCAACAAAACCAAACGTTGAAAGA
AGAAATACAAGACATTACGAACACACCCAACACTAACGAAGCACAACAAG
AACTACTCATCAAGGAATTGGAACGAGCACGTAAATGGATCGATAAACTC
GAAGAGGAGAATCGAGCTgttgaagaaagaaaaaggttGGCAGAGGATTT
ACAGAAAAACGACAAAGAATTGATTGACATCCTACGGAACCAGTGCGGGT
CGCTGGAAGAGGATTTAACGACAGAACAAGATCGTAACAGCCAACTAGAA
GACAAACTGAAACTACTCGACATGATGCGATCTGACTTTCTCAAAGAACA
AGAAAAACATGTCAAAACAACCAAAGAATTAGAATCGATGCGTCAAAAGA
TAAAACGCCGTGATAGGCACATTGAAGACTTAGAAGACGACAATGTGAAA
CTGCAACAACTAAAACAAGAACTTGAATCTAATATGGCTAAGAAAGAATT
CAAGATCAAAAAAGTCGAAAAGAAAGTATCTGTTCTGCAACACGAGGTTA
TACACTGTAACAAACAGATCGCTGACCTGACCGGCGAAAACAAGACTTTA
GAACAGGTCAAACGTCTTACAGATCTCAAATTAAAAGACATGTCTAGCAT
CGCGCAACAGTCGGGCAACGGTGGCACAAACAGTGGTACAACAGAGGTTG
CTACTAACGAACAATTCTTTATAAATACACTCGAAGATCGTTTAAAACAT
CGCGAATCACGTCTTAAAGAACTTGAACtggaaaatgataattatttaaa
agaaattaaagGCGTTTATGATAATTTATTGGACGTCGAACGACAGCGAG
AGGAATGTAAGGAACAGATAAAGGATAATGAAATCAGGTTATCTAAGCta
cgaaaagaaaacaaaaatgcgGAAAAGAAGATTGAACTATTACATCGTAA
ATTACAGAAAAGTGAAAAAGAGAAACGTAGAGCTTTGAATAAACAGACTC
AAGCTGAAATGAAATTGTCGCAGTATCACCAAGAACAGGAGTCAGTGGCC
ATGGCGTTGAGCGCGGCACGCATTGCTGAAAATACAGCCGATCAACAGGC
TACGTATGATTCAAGTGACGATTCTGATTCTAGAATTTTGAAGTTGAAAT
TACAATCGACTGAAGCAAGGTTATCGATGATTGAAGTCAATAAAGGATAT
CTAGAATCGAAAGTGATCAATTTGGAACGAAAGCTTATGGATAAAGAACA
AGAGATCTTACGTCTAAACGATTCCATGGAACGCGATTCTGGAGCCCCGT
CGCAAGACTATGATCGATTCGACGCATTAGAACGTGAAAACATCATGTTA
CAGACTAAGCTGGACGAACTATCCCTTGAAAATGCTGAACAAAAGGATAT
GGTGAATAAACTGAAAGAAGGAAATACACACTTAGAGAAAACGATACAGA
ATTTGAACACGAAGTTAGATTCGTGTACGTTCCGACTTAAAGAACTTGAA
GAAGCAAACCATAAATTGGGCAGGGAAGCATTGAAAAGAAATGAATCTAT
TAGTTGTGCACATGATGAAGTGACGTCGAGTTTGAACGAGCTCAAAGAGC
ATAACAAAACTCTACAGGACAAATTGAAGCATTTCGAAAACGTCGAAGAC
CTCGTGGAGCAATTAGAACAACAAGTGAAAATGGAACAATCCTATGTCCA
ATGGTATTTCGACGAAAAcgaaaaactcaaaatacaaACAGCCAAAATGG
CGGACACTATTCGGACATTAGAACGTTCGAAATTCGAATTCGAACAAAGC
GTCCGTGAATTATCGGACACGAACAAGGACTTGAATAACGACGTGAAACG
TTTAgaacaaaaacttgaaatataCACAGAATTATTCGATAAAGACTCTA
ATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAGGGTGGTGAAAATAAT
CAAGAACAAGCAGAcgaaaaattaatagaaaacGCCCTGGCACCATTAAt
ggaagaaatcaaagaaaaagattcACAAATACGAAATTTACAAAAGCTAG
TCGAAGAGAAAGACGTTACTATCACGTCCTTAAACAAAGAAATTGATACA
CTAGAAACGAATTTAGCCTCGATGGTAATGGAGAAAATACGTGGTATGCA
AATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAAGTGCTGCATCACATA
ATGGGCTTTTCTCTACCGACTCTTTACAAGAACTTAAACAAGCTTATAAA
CTTTCTACTCAAAACGATAAAGACACGATTTTATCAAATCAGCACACAGA
TGGAGAACACGATAAACTAAATAAGGATCAAAAGACACTTCATAGACTCT
CCTTCTTTGATGATTCACATAAAATTCGTATCGGAGAACCATGTACTTTA
TTACTTTCAACTACTGATGTAACAGCGAGCCATGATCATTCAACGAAGGG
ACCTCAAGTCTCACCGACGCCAATTTATCAAACGCCGACGTCATCGGGCC
CTCAGTCCCCATCCAAAGAGACCTATTTAGCACTAACATCAAAAACAGTG
AATAGCCCGAAAGAGGAATCGACAGGCCATTACGAACAATTATACTCTGG
TTCAAGCAGTAATCCAACAAGCCCTCGTTCCTCACGTCCCAGCTCCAACA
TTTACCAAACAATAGAATCCGCCATTTTGGACCAATACCGAGGTGACGAT
CAACATTGTTACCTGAAATCAAACATCCCTCCTCTTGATAGTCGGCACGG
TGAGAGCCCGCCCTACACGTCATATATTGAATCAGCGGCCGCCGGGCTGG
GTCTAAACCGCAGCGATGTTGATCGTAAAAGTATTTCTAATATGGCCGAA
AATAAGGCTTTAGTGGATGATATGTATGACCAATTAGCCTTACTCGAGGA
TCTGGTTTCGAAGAAAAACATGCCTCCACCGTTAAGTCCGTCTGCCGTGT
CTCCAACGAAAACTAGAGACGTCGCTAAACCCGTTAAAGTCTCGACATCG
GAAAATGATACGTCAAACGACGACTCTTCGCAACCGGCTTCCCCGAATAA
AGAGAGCGGGCACAAAGCATCTTCGCACATCCGGATCCCGAAATTAAGTC
AACGGCAATCGAGTCGAGAATCAAATCTTGGTTTACCATCGAACACAAAG
TTACTTTGTCGTACGCCATCAACGAGTAGCTCGCATTCACAAGATAGCAC
CTGTATAGATTTATCGGGGCTGGATGATTTGTTAGCAGAAGTTGATGGCC
ACAGGGGAGGCTCGCATGCACATGAGAAATATGCCAGTGTTGttcagGAA
AGCAAACGTCGTTCGGTATCAGGGTTAGAACACAAACCGGTGTTATCGAA
AACCATGCCCGTCCCTTCCATTCGAAACACTCGTAGACGAATCATCAAAG
TTAGCGGATTAAATCGAACTGGGTCCTTCGATAGCACTCGAGTTAAACCG
AAAATCTTATCTTCAAACACCATCATATCGCACAGTTCATCTAGCCTACC
ATCCACTACTAAACATCGTAATGTGAACGTAGAAATCCCGGCTAGTCGTC
TCCTTGACAACAACACGTCAACATCCTCTTTAGCAACCTCCTCTTCTTCA
AGCGTTTCCagCGTTATTTATGTTCCAGATAAAGACGGAAACGTCTCCAT
TCCTCCTACAACTGGTACATCAACGTCACAAGATAAACCACAGACTACGT
CTGCTACGGGTCCGGCTCCCACTTCGGCCAACGACCCAACGTCTTCGATT
TCGGCGACTAGTAACCCGCCTTTTCGTCGACCGTCACTCAAACAAAGTCg
ctttttgacttcaaattcAAATATTGGGTCATGAATGGcacaagaaaatg
atgaaagtTTTGTCAAGGACATTTGTAGGGATTTTATACCACAGAAATGG
CGAAAAACAAAATGCCAAACCTGCTTCAAAGATATCATTGAACACACAAA
AGGTTTGACTCATGAAGAATCCGAGACGTTTATAAAGCAATGTATGGATG
AAACTGACAATGATGATGATTGTTTTGAAACTCAAACAGAAGAAACATTC
AGAAAAATATCTAGAGGAAGAAATATCATAACATCAACATCAACAATTGT
TGCTGAAAATGAACAGCCATGTTTTCAAGAACCTCATTGTCATCAACATC
ATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAGAAGCTCTaaagAAAAT
TCATTAGATGTAGATgtcaatgacgtcatgaaaGGACGGCCCGTCGATTC
TGAGAACGAGGCAGACGACCCGCTGACAGAAAATGAAGGAATGAACACTC
CACTACTCACTAGAAGGAAAAGGCATTCATCAGGGTATCCGTTCGAACAT
ATGGATAGTCACGAAAACACGGAGGATGGCACGACCACACCAAATCGTAT
CTCCTCCAAATCGAGATCCAGATCACGCACGAAAGGGAAAAGCCAATCGA
ATTTACTGTCTTTGTCGGCGATGATGTTGTCATCAAATTCATCTTTGTGT
AGTTACACTAGTGAACTCACTGATGgTTACTCCGATTACGATTACGACGT
TCGCTCCATTACCGACGACACTGACGATTACGCCGATATTCCCGATGTTG
TAATTGAGGAACTGGAACTTATCAAACCCGAGCTTAAAGCGCGCGTTGAA
AACGAACGCCGTGTATCTCGGTCACGTATCATTAGCCTGGAGAGAGAATT
AGAAGGTCAACATGATTACCACAGAGCCAGTGAAGTTGCGAGAGATCGAC
AGTTGAAGTCTTTACAACGCGATATTGAAGGTTTGAAGTTGGAATTATCA
AGTGTGAAAGCTCATGAAAATATTCTGGCATTGAAAAGCCGTTTAGAACT
TGAAGgtaaaaacagtagaatCCACGACTTGGAGCAACAAAACCAAACGT
TGAAAGAAGAAATACAAGACATTACGAACACACCCAACACTAACGAAGCA
CAACAAGAACTACTCATCAAGGAATTGGAACGAGCACGTAAATGGATCGA
TAAACTCGAAGAGGAGAATCGAGCTgttgaagaaagaaaaaggttGGCAG
AGGATTTACAGAAAAACGACAAAGAATTGATTGACATCCTACGGAACCAG
TGCGGGTCGCTGGAAGAGGATTTAACGACAGAACAAGATCGTAACAGCCA
ACTAGAAGACAAACTGAAACTACTCGACATGATGCGATCTGACTTTCTCA
AAGAACAAGAAAAACATGTCAAAACAACCAAAGAATTAGAATCGATGCGT
CAAAAGATAAAACGCCGTGATAGGCACATTGAAGACTTAGAAGACGACAA
TGTGAAACTGCAACAACTAAAACAAGAACTTGAATCTAATATGGCTAAGA
AAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGTATCTGTTCTGCAACAC
GAGGTTATACACTGTAACAAACAGATCGCTGACCTGACCGGCGAAAACAA
GACTTTAGAACAGGTCAAACGTCTTACAGATCTCAAATTAAAAGACATGT
CTAGCATCGCGCAACAGTCGGGCAACGGTGGCACAAACAGTGGTACAACA
GAGGTTGCTACTAACGAACAATTCTTTATAAATACACTCGAAGATCGTTT
AAAACATCGCGAATCACGTCTTAAAGAACTTGAACtggaaaatgataatt
atttaaaagaaattaaagGCGTTTATGATAATTTATTGGACGTCGAACGA
CAGCGAGAGGAATGTAAGGAACAGATAAAGGATAATGAAATCAGGTTATC
TAAGCtacgaaaagaaaacaaaaatgcgGAAAAGAAGATTGAACTATTAC
ATCGTAAATTACAGAAAAGTGAAAAAGAGAAACGTAGAGCTTTGAATAAA
CAGACTCAAGCTGAAATGAAATTGTCGCAGTATCACCAAGAACAGGAGTC
AGTGGCCATGGCGTTGAGCGCGGCACGCATTGCTGAAAATACAGCCGATC
AACAGGCTACGTATGATTCAAGTGACGATTCTGATTCTAGAATTTTGAAG
TTGAAATTACAATCGACTGAAGCAAGGTTATCGATGATTGAAGTCAATAA
AGGATATCTAGAATCGAAAGTGATCAATTTGGAACGAAAGCTTATGGATA
AAGAACAAGAGATCTTACGTCTAAACGATTCCATGGAACGCGATTCTGGA
GCCCCGTCGCAAGACTATGATCGATTCGACGCATTAGAACGTGAAAACAT
CATGTTACAGACTAAGCTGGACGAACTATCCCTTGAAAATGCTGAACAAA
AGGATATGGTGAATAAACTGAAAGAAGGAAATACACACTTAGAGAAAACG
ATACAGAATTTGAACACGAAGTTAGATTCGTGTACGTTCCGACTTAAAGA
ACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAGCATTGAAAAGAAATG
AATCTATTAGTTGTGCACATGATGAAGTGACGTCGAGTTTGAACGAGCTC
AAAGAGCATAACAAAACTCTACAGGACAAATTGAAGCATTTCGAAAACGT
CGAAGACCTCGTGGAGCAATTAGAACAACAAGTGAAAATGGAACAATCCT
ATGTCCAATGGTATTTCGACGAAAAcgaaaaactcaaaatacaaACAGCC
AAAATGGCGGACACTATTCGGACATTAGAACGTTCGAAATTCGAATTCGA
ACAAAGCGTCCGTGAATTATCGGACACGAACAAGGACTTGAATAACGACG
TGAAACGTTTAgaacaaaaacttgaaatataCACAGAATTATTCGATAAA
GACTCTAATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAGGGTGGTGA
AAATAATCAAGAACAAGCAGAcgaaaaattaatagaaaacGCCCTGGCAC
CATTAAtggaagaaatcaaagaaaaagattcACAAATACGAAATTTACAA
AAGCTAGTCGAAGAGAAAGACGTTACTATCACGTCCTTAAACAAAGAAAT
TGATACACTAGAAACGAATTTAGCCTCGATGGTAATGGAGAAAATACGTG
GTATGCAAATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAAGTGCTGCA
TCACATAATGGGCTTTTCTCTACCGACTCTTTACAAGAACTTAAACAAGC
TTATAAACTTTCTACTCAAAACGATAAAGACACGATTTTATCAAATCAGC
ACACAGATGGAGAACACGATAAACTAAATAAGGATCAAAAGACACTTCAT
AGACTCTCCTTCTTTGATGATTCACATAAAATTCGTATCGGAGAACCATG
TACTTTATTACTTTCAACTACTGATGTAACAGCGAGCCATGATCATTCAA
CGAAGGGACCTCAAGTCTCACCGACGCCAATTTATCAAACGCCGACGTCA
TCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTTAGCACTAACATCAAA
AACAGTGAATAGCCCGAAAGAGGAATCGACAGGCCATTACGAACAATTAT
ACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCGTTCCTCACGTCCCAGC
TCCAACATTTACCAAACAATAGAATCCGCCATTTTGGACCAATACCGAGG
TGACGATCAACATTGTTACCTGAAATCAAACATCCCTCCTCTTGATAGTC
GGCACGGTGAGAGCCCGCCCTACACGTCATATATTGAATCAGCGGCCGCC
GGGCTGGGTCTAAACCGCAGCGATGTTGATCGTAAAAGTATTTCTAATAT
GGCCGAAAATAAGGCTTTAGTGGATGATATGTATGACCAATTAGCCTTAC
TCGAGGATCTGGTTTCGAAGAAAAACATGCCTCCACCGTTAAGTCCGTCT
GCCGTGTCTCCAACGAAAACTAGAGACGTCGCTAAACCCGTTAAAGTCTC
GACATCGGAAAATGATACGTCAAACGACGACTCTTCGCAACCGGCTTCCC
CGAATAAAGAGAGCGGGCACAAAGCATCTTCGCACATCCGGATCCCGAAA
TTAAGTCAACGGCAATCGAGTCGAGAATCAAATCTTGGTTTACCATCGAA
CACAAAGTTACTTTGTCGTACGCCATCAACGAGTAGCTCGCATTCACAAG
ATAGCACCTGTATAGATTTATCGGGGCTGGATGATTTGTTAGCAGAAGTT
GATGGCCACAGGGGAGGCTCGCATGCACATGAGAAATATGCCAGTGTTGt
tcagGAAAGCAAACGTCGTTCGGTATCAGGGTTAGAACACAAACCGGTGT
TATCGAAAACCATGCCCGTCCCTTCCATTCGAAACACTCGTAGACGAATC
ATCAAAGTTAGCGGATTAAATCGAACTGGGTCCTTCGATAGCACTCGAGT
TAAACCGAAAATCTTATCTTCAAACACCATCATATCGCACAGTTCATCTA
GCCTACCATCCACTACTAAACATCGTAATGTGAACGTAGAAATCCCGGCT
AGTCGTCTCCTTGACAACAACACGTCAACATCCTCTTTAGCAACCTCCTC
TTCTTCAAGCGTTTCCagCGTTATTTATGTTCCAGATAAAGACGGAAACG
TCTCCATTCCTCCTACAACTGGTACATCAACGTCACAAGATAAACCACAG
ACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGCCAACGACCCAACGTC
TTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTCGACCGTCACTCAAAC
AAAGTCgctttttgacttcaaattcAAATATTGGGTCATGAATGGcacaa
gaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGATTTTATACCACA
GAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAGATATCATTGAAC
ACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTTATAAAGCAATGT
ATGGATGAAACTGACAATGATGATGATTGTTTTGAAACTCAAACAGAAGA
AACATTCAGAAAAATATCTAGAGGAAGAAATATCATAACATCAACATCAA
CAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAACCTCATTGTCAT
CAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAGAAGCTCTaa
agAAAATTCATTAGATGTAGATgtcaatgacgtcatgaaaGGACGGCCCG
TCGATTCTGAGAACGAGGCAGACGACCCGCTGACAGAAAATGAAGGAATG
AACACTCCACTACTCACTAGAAGGAAAAGGCATTCATCAGGGTATCCGTT
CGAACATATGGATAGTCACGAAAACACGGAGGATGGCACGACCACACCAA
ATCGTATCTCCTCCAAATCGAGATCCAGATCACGCACGAAAGGGAAAAGC
CAATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTCATCAAATTCATC
TTTGTGTAGTTACACTAGTGAACTCACTGATGgTTACTCCGATTACGATT
ACGACGTTCGCTCCATTACCGACGACACTGACGATTACGCCGATATTCCC
GATGTTGTAATTGAGGAACTGGAACTTATCAAACCCGAGCTTAAAGCGCG
CGTTGAAAACGAACGCCGTGTATCTCGGTCACGTATCATTAGCCTGGAGA
GAGAATTAGAAGGTCAACATGATTACCACAGAGCCAGTGAAGTTGCGAGA
GATCGACAGTTGAAGTCTTTACAACGCGATATTGAAGGTTTGAAGTTGGA
ATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCATTGAAAAGCCGTT
TAGAACTTGAAGgtaaaaacagtagaatCCACGACTTGGAGCAACAAAAC
CAAACGTTGAAAGAAGAAATACAAGACATTACGAACACACCCAACACTAA
CGAAGCACAACAAGAACTACTCATCAAGGAATTGGAACGAGCACGTAAAT
GGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaagaaagaaaaagg
ttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGATTGACATCCTACG
GAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGACAGAACAAGATCGTA
ACAGCCAACTAGAAGACAAACTGAAACTACTCGACATGATGCGATCTGAC
TTTCTCAAAGAACAAGAAAAACATGTCAAAACAACCAAAGAATTAGAATC
GATGCGTCAAAAGATAAAACGCCGTGATAGGCACATTGAAGACTTAGAAG
ACGACAATGTGAAACTGCAACAACTAAAACAAGAACTTGAATCTAATATG
GCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGTATCTGTTCT
GCAACACGAGGTTATACACTGTAACAAACAGATCGCTGACCTGACCGGCG
AAAACAAGACTTTAGAACAGGTCAAACGTCTTACAGATCTCAAATTAAAA
GACATGTCTAGCATCGCGCAACAGTCGGGCAACGGTGGCACAAACAGTGG
TACAACAGAGGTTGCTACTAACGAACAATTCTTTATAAATACACTCGAAG
ATCGTTTAAAACATCGCGAATCACGTCTTAAAGAACTTGAACtggaaaat
gataattatttaaaagaaattaaagGCGTTTATGATAATTTATTGGACGT
CGAACGACAGCGAGAGGAATGTAAGGAACAGATAAAGGATAATGAAATCA
GGTTATCTAAGCtacgaaaagaaaacaaaaatgcgGAAAAGAAGATTGAA
CTATTACATCGTAAATTACAGAAAAGTGAAAAAGAGAAACGTAGAGCTTT
GAATAAACAGACTCAAGCTGAAATGAAATTGTCGCAGTATCACCAAGAAC
AGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCATTGCTGAAAATACA
GCCGATCAACAGGCTACGTATGATTCAAGTGACGATTCTGATTCTAGAAT
TTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTTATCGATGATTGAAG
TCAATAAAGGATATCTAGAATCGAAAGTGATCAATTTGGAACGAAAGCTT
ATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTCCATGGAACGCGA
TTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACGCATTAGAACGTG
AAAACATCATGTTACAGACTAAGCTGGACGAACTATCCCTTGAAAATGCT
GAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAATACACACTTAGA
GAAAACGATACAGAATTTGAACACGAAGTTAGATTCGTGTACGTTCCGAC
TTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAGCATTGAAA
AGAAATGAATCTATTAGTTGTGCACATGATGAAGTGACGTCGAGTTTGAA
CGAGCTCAAAGAGCATAACAAAACTCTACAGGACAAATTGAAGCATTTCG
AAAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAAGTGAAAATGGAA
CAATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaaactcaaaataca
aACAGCCAAAATGGCGGACACTATTCGGACATTAGAACGTTCGAAATTCG
AATTCGAACAAAGCGTCCGTGAATTATCGGACACGAACAAGGACTTGAAT
AACGACGTGAAACGTTTAgaacaaaaacttgaaatataCACAGAATTATT
CGATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGCGGTCTTATCAGG
GTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaattaatagaaaacGCC
CTGGCACCATTAAtggaagaaatcaaagaaaaagattcACAAATACGAAA
TTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCACGTCCTTAAACA
AAGAAATTGATACACTAGAAACGAATTTAGCCTCGATGGTAATGGAGAAA
ATACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGTTCGCCAAGAAAG
TGCTGCATCACATAATGGGCTTTTCTCTACCGACTCTTTACAAGAACTTA
AACAAGCTTATAAACTTTCTACTCAAAACGATAAAGACACGATTTTATCA
AATCAGCACACAGATGGAGAACACGATAAACTAAATAAGGATCAAAAGAC
ACTTCATAGACTCTCCTTCTTTGATGATTCACATAAAATTCGTATCGGAG
AACCATGTACTTTATTACTTTCAACTACTGATGTAACAGCGAGCCATGAT
CATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAATTTATCAAACGCC
GACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTTAGCACTAA
CATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGACAGGCCATTACGAA
CAATTATACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCGTTCCTCACG
TCCCAGCTCCAACATTTACCAAACAATAGAATCCGCCATTTTGGACCAAT
ACCGAGGTGACGATCAACATTGTTACCTGAAATCAAACATCCCTCCTCTT
GATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCATATATTGAATCAGC
GGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGATCGTAAAAGTATTT
CTAATATGGCCGAAAATAAGGCTTTAGTGGATGATATGTATGACCAATTA
GCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATGCCTCCACCGTTAAG
TCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGTCGCTAAACCCGTTA
AAGTCTCGACATCGGAAAATGATACGTCAAACGACGACTCTTCGCAACCG
GCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCTTCGCACATCCGGAT
CCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATCAAATCTTGGTTTAC
CATCGAACACAAAGTTACTTTGTCGTACGCCATCAACGAGTAGCTCGCAT
TCACAAGATAGCACCTGTATAGATTTATCGGGGCTGGATGATTTGTTAGC
AGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACATGAGAAATATGCCA
GTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAGGGTTAGAACACAAA
CCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATTCGAAACACTCGTAG
ACGAATCATCAAAGTTAGCGGATTAAATCGAACTGGGTCCTTCGATAGCA
CTCGAGTTAAACCGAAAATCTTATCTTCAAACACCATCATATCGCACAGT
TCATCTAGCCTACCATCCACTACTAAACATCGTAATGTGAACGTAGAAAT
CCCGGCTAGTCGTCTCCTTGACAACAACACGTCAACATCCTCTTTAGCAA
CCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATGTTCCAGATAAAGAC
GGAAACGTCTCCATTCCTCCTACAACTGGTACATCAACGTCACAAGATAA
ACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGCCAACGACC
CAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTCGACCGTCA
CTCAAACAAAGTCgctttttgacttcaaattcAAATATTGGGTCATGAAT
GGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAGGGATTTTA
TACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAAAGATATC
ATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACGTTTATAAA
GCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGAAACTCAAA
CAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCATAACATCA
ACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAGAACCTCA
TTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAAGGAAGAA
GCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtcatgaaaGGA
CGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGACAGAAAATGA
AGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATTCATCAGGGT
ATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGATGGCACGACC
ACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACGCACGAAAGG
GAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGTTGTCATCAA
ATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgTTACTCCGAT
TACGATTACGACGTTCGCTCCATTACCGACGACACTGACGATTACGCCGA
TATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAACCCGAGCTTA
AAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTATCATTAGC
CTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGCCAGTGAAGT
TGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTGAAGGTTTGA
AGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGCATTGAAA
AGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGACTTGGAGCA
ACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGAACACACCCA
ACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTGGAACGAGCA
CGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttgaagaaag
aaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAATTGATTGACA
TCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGACAGAACAA
GATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGACATGATGCG
ATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAACCAAAGAAT
TAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCACATTGAAGAC
TTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGAACTTGAATC
TAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAGAAAGTAT
CTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATCGCTGACCTG
ACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTACAGATCTCAA
ATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACGGTGGCACAA
ACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTTATAAATACA
CTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGAACTTGAACt
ggaaaatgataattatttaaaagaaattaaagGCGTTTATGATAATTTAT
TGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATAAAGGATAAT
GAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgcgGAAAAGAA
GATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAGAGAAACGTA
GAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCGCAGTATCAC
CAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCATTGCTGA
AAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACGATTCTGATT
CTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTTATCGATG
ATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAATTTGGAACG
AAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGATTCCATGG
AACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGACGCATTA
GAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTATCCCTTGA
AAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGAAATACAC
ACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATTCGTGTACG
TTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCAGGGAAGC
ATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGTGACGTCGA
GTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGACAAATTGAAG
CATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAACAAGTGAA
AATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcgaaaaactca
aaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTAGAACGTTCG
AAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACACGAACAAGGA
CTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaatataCACAG
AATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAAAGGCGGTCT
TATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaattaataga
aaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaagattcACAAA
TACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTATCACGTCC
TTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTCGATGGTAAT
GGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAAAAGTTCGCC
AAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGACTCTTTACAA
GAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAAAGACACGAT
TTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAAATAAGGATC
AAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACATAAAATTCGT
ATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGTAACAGCGAG
CCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGCCAATTTATC
AAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGACCTATTTA
GCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGACAGGCCA
TTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAAGCCCTCGTT
CCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCCGCCATTTTG
GACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATCAAACATCCC
TCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCATATATTG
AATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGATCGTAAA
AGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGATATGTATGA
CCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATGCCTCCAC
CGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGTCGCTAAA
CCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGACGACTCTTC
GCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCTTCGCACA
TCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATCAAATCTT
GGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATCAACGAGTAG
CTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGCTGGATGATT
TGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACATGAGAAA
TATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAGGGTTAGA
ACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATTCGAAACA
CTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACTGGGTCCTTC
GATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACACCATCATATC
GCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTAATGTGAACG
TAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAACATCCTCT
TTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATGTTCCAGA
TAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATCAACGTCAC
AAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCACTTCGGCC
AACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTTTTCGTCG
ACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAATATTGGGT
CATGAATGGcacaagaaaatgatgaaagtTTTGTCAAGGACATTTGTAGG
GATTTTATACCACAGAAATGGCGAAAAACAAAATGCCAAACCTGCTTCAA
AGATATCATTGAACACACAAAAGGTTTGACTCATGAAGAATCCGAGACGT
TTATAAAGCAATGTATGGATGAAACTGACAATGATGATGATTGTTTTGAA
ACTCAAACAGAAGAAACATTCAGAAAAATATCTAGAGGAAGAAATATCAT
AACATCAACATCAACAATTGTTGCTGAAAATGAACAGCCATGTTTTCAAG
AACCTCATTGTCATCAACATCATCATCAAAGGAGAAGGCAATTTTCTCAA
GGAAGAAGCTCTaaagAAAATTCATTAGATGTAGATgtcaatgacgtcat
gaaaGGACGGCCCGTCGATTCTGAGAACGAGGCAGACGACCCGCTGACAG
AAAATGAAGGAATGAACACTCCACTACTCACTAGAAGGAAAAGGCATTCA
TCAGGGTATCCGTTCGAACATATGGATAGTCACGAAAACACGGAGGATGG
CACGACCACACCAAATCGTATCTCCTCCAAATCGAGATCCAGATCACGCA
CGAAAGGGAAAAGCCAATCGAATTTACTGTCTTTGTCGGCGATGATGTTG
TCATCAAATTCATCTTTGTGTAGTTACACTAGTGAACTCACTGATGgTTA
CTCCGATTACGATTACGACGTTCGCTCCATTACCGACGACACTGACGATT
ACGCCGATATTCCCGATGTTGTAATTGAGGAACTGGAACTTATCAAACCC
GAGCTTAAAGCGCGCGTTGAAAACGAACGCCGTGTATCTCGGTCACGTAT
CATTAGCCTGGAGAGAGAATTAGAAGGTCAACATGATTACCACAGAGCCA
GTGAAGTTGCGAGAGATCGACAGTTGAAGTCTTTACAACGCGATATTGAA
GGTTTGAAGTTGGAATTATCAAGTGTGAAAGCTCATGAAAATATTCTGGC
ATTGAAAAGCCGTTTAGAACTTGAAGgtaaaaacagtagaatCCACGACT
TGGAGCAACAAAACCAAACGTTGAAAGAAGAAATACAAGACATTACGAAC
ACACCCAACACTAACGAAGCACAACAAGAACTACTCATCAAGGAATTGGA
ACGAGCACGTAAATGGATCGATAAACTCGAAGAGGAGAATCGAGCTgttg
aagaaagaaaaaggttGGCAGAGGATTTACAGAAAAACGACAAAGAATTG
ATTGACATCCTACGGAACCAGTGCGGGTCGCTGGAAGAGGATTTAACGAC
AGAACAAGATCGTAACAGCCAACTAGAAGACAAACTGAAACTACTCGACA
TGATGCGATCTGACTTTCTCAAAGAACAAGAAAAACATGTCAAAACAACC
AAAGAATTAGAATCGATGCGTCAAAAGATAAAACGCCGTGATAGGCACAT
TGAAGACTTAGAAGACGACAATGTGAAACTGCAACAACTAAAACAAGAAC
TTGAATCTAATATGGCTAAGAAAGAATTCAAGATCAAAAAAGTCGAAAAG
AAAGTATCTGTTCTGCAACACGAGGTTATACACTGTAACAAACAGATCGC
TGACCTGACCGGCGAAAACAAGACTTTAGAACAGGTCAAACGTCTTACAG
ATCTCAAATTAAAAGACATGTCTAGCATCGCGCAACAGTCGGGCAACGGT
GGCACAAACAGTGGTACAACAGAGGTTGCTACTAACGAACAATTCTTTAT
AAATACACTCGAAGATCGTTTAAAACATCGCGAATCACGTCTTAAAGAAC
TTGAACtggaaaatgataattatttaaaagaaattaaagGCGTTTATGAT
AATTTATTGGACGTCGAACGACAGCGAGAGGAATGTAAGGAACAGATAAA
GGATAATGAAATCAGGTTATCTAAGCtacgaaaagaaaacaaaaatgcgG
AAAAGAAGATTGAACTATTACATCGTAAATTACAGAAAAGTGAAAAAGAG
AAACGTAGAGCTTTGAATAAACAGACTCAAGCTGAAATGAAATTGTCGCA
GTATCACCAAGAACAGGAGTCAGTGGCCATGGCGTTGAGCGCGGCACGCA
TTGCTGAAAATACAGCCGATCAACAGGCTACGTATGATTCAAGTGACGAT
TCTGATTCTAGAATTTTGAAGTTGAAATTACAATCGACTGAAGCAAGGTT
ATCGATGATTGAAGTCAATAAAGGATATCTAGAATCGAAAGTGATCAATT
TGGAACGAAAGCTTATGGATAAAGAACAAGAGATCTTACGTCTAAACGAT
TCCATGGAACGCGATTCTGGAGCCCCGTCGCAAGACTATGATCGATTCGA
CGCATTAGAACGTGAAAACATCATGTTACAGACTAAGCTGGACGAACTAT
CCCTTGAAAATGCTGAACAAAAGGATATGGTGAATAAACTGAAAGAAGGA
AATACACACTTAGAGAAAACGATACAGAATTTGAACACGAAGTTAGATTC
GTGTACGTTCCGACTTAAAGAACTTGAAGAAGCAAACCATAAATTGGGCA
GGGAAGCATTGAAAAGAAATGAATCTATTAGTTGTGCACATGATGAAGTG
ACGTCGAGTTTGAACGAGCTCAAAGAGCATAACAAAACTCTACAGGACAA
ATTGAAGCATTTCGAAAACGTCGAAGACCTCGTGGAGCAATTAGAACAAC
AAGTGAAAATGGAACAATCCTATGTCCAATGGTATTTCGACGAAAAcgaa
aaactcaaaatacaaACAGCCAAAATGGCGGACACTATTCGGACATTAGA
ACGTTCGAAATTCGAATTCGAACAAAGCGTCCGTGAATTATCGGACACGA
ACAAGGACTTGAATAACGACGTGAAACGTTTAgaacaaaaacttgaaata
taCACAGAATTATTCGATAAAGACTCTAATTTTCATACCTCCCTCAAAAG
GCGGTCTTATCAGGGTGGTGAAAATAATCAAGAACAAGCAGAcgaaaaat
taatagaaaacGCCCTGGCACCATTAAtggaagaaatcaaagaaaaagat
tcACAAATACGAAATTTACAAAAGCTAGTCGAAGAGAAAGACGTTACTAT
CACGTCCTTAAACAAAGAAATTGATACACTAGAAACGAATTTAGCCTCGA
TGGTAATGGAGAAAATACGTGGTATGCAAATCCCCGACGATGCCGAAAAA
GTTCGCCAAGAAAGTGCTGCATCACATAATGGGCTTTTCTCTACCGACTC
TTTACAAGAACTTAAACAAGCTTATAAACTTTCTACTCAAAACGATAAAG
ACACGATTTTATCAAATCAGCACACAGATGGAGAACACGATAAACTAAAT
AAGGATCAAAAGACACTTCATAGACTCTCCTTCTTTGATGATTCACATAA
AATTCGTATCGGAGAACCATGTACTTTATTACTTTCAACTACTGATGTAA
CAGCGAGCCATGATCATTCAACGAAGGGACCTCAAGTCTCACCGACGCCA
ATTTATCAAACGCCGACGTCATCGGGCCCTCAGTCCCCATCCAAAGAGAC
CTATTTAGCACTAACATCAAAAACAGTGAATAGCCCGAAAGAGGAATCGA
CAGGCCATTACGAACAATTATACTCTGGTTCAAGCAGTAATCCAACAAGC
CCTCGTTCCTCACGTCCCAGCTCCAACATTTACCAAACAATAGAATCCGC
CATTTTGGACCAATACCGAGGTGACGATCAACATTGTTACCTGAAATCAA
ACATCCCTCCTCTTGATAGTCGGCACGGTGAGAGCCCGCCCTACACGTCA
TATATTGAATCAGCGGCCGCCGGGCTGGGTCTAAACCGCAGCGATGTTGA
TCGTAAAAGTATTTCTAATATGGCCGAAAATAAGGCTTTAGTGGATGATA
TGTATGACCAATTAGCCTTACTCGAGGATCTGGTTTCGAAGAAAAACATG
CCTCCACCGTTAAGTCCGTCTGCCGTGTCTCCAACGAAAACTAGAGACGT
CGCTAAACCCGTTAAAGTCTCGACATCGGAAAATGATACGTCAAACGACG
ACTCTTCGCAACCGGCTTCCCCGAATAAAGAGAGCGGGCACAAAGCATCT
TCGCACATCCGGATCCCGAAATTAAGTCAACGGCAATCGAGTCGAGAATC
AAATCTTGGTTTACCATCGAACACAAAGTTACTTTGTCGTACGCCATCAA
CGAGTAGCTCGCATTCACAAGATAGCACCTGTATAGATTTATCGGGGCTG
GATGATTTGTTAGCAGAAGTTGATGGCCACAGGGGAGGCTCGCATGCACA
TGAGAAATATGCCAGTGTTGttcagGAAAGCAAACGTCGTTCGGTATCAG
GGTTAGAACACAAACCGGTGTTATCGAAAACCATGCCCGTCCCTTCCATT
CGAAACACTCGTAGACGAATCATCAAAGTTAGCGGATTAAATCGAACTGG
GTCCTTCGATAGCACTCGAGTTAAACCGAAAATCTTATCTTCAAACACCA
TCATATCGCACAGTTCATCTAGCCTACCATCCACTACTAAACATCGTAAT
GTGAACGTAGAAATCCCGGCTAGTCGTCTCCTTGACAACAACACGTCAAC
ATCCTCTTTAGCAACCTCCTCTTCTTCAAGCGTTTCCagCGTTATTTATG
TTCCAGATAAAGACGGAAACGTCTCCATTCCTCCTACAACTGGTACATCA
ACGTCACAAGATAAACCACAGACTACGTCTGCTACGGGTCCGGCTCCCAC
TTCGGCCAACGACCCAACGTCTTCGATTTCGGCGACTAGTAACCCGCCTT
TTCGTCGACCGTCACTCAAACAAAGTCgctttttgacttcaaattcAAAT
ATTGGGTCATGA
Gene-mRNA-Prot