TCONS_00000074 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000074
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length771

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000074 ID=TCONS_00000074|Name=|organism=Clytia hemisphaerica|type=transcript|length=771bp
TAATCATAATAAATGCAAGCTTGGGCAGAATGTTTGACTGGTGGATTAGC
AGCTTGCTGTGCTTGTGTTTTCAGCAATCCTTTAGAAGTTGTCAAAACTC
GAATGCAACTCCAAGGTGAACTACAGgctTCCGGAACATACAAAGTACAC
TACcgaaatttttttcatgcatTTTACACTATTGGAAAGAACGATGGAAT
ACTTGCATTGCAAAAGGGACTGGGTCTTGGGATGACTTATCAATTCATTA
TGAATGGTATAAGACTTGGAACTTTTCAACAGATTACAAATGCTGGCTTG
ACGAAAGATGACGAAGGAAATCTCAGTTTACCCAAATGTTTAATTGGTGG
TGCAGTCTCTGGTTGCCTTGGAGCTTTTGTTGCAAGTCCTTCATATATGC
TCAAAACGCAACTTCAAGCCAAAGCAAACACAGCGATTGCAGTTGGTACA
CAACACGATATTCAGAGCGTCTCATCAACACTAAAAACCATCTTCCAAAA
CCACGGTATCACTGGTTTATGGCGCGGTGCTTCCGGTGCAATGTTACGCG
TGACGTTTGGGTCAGCCTCCCAGCTAACAGCCTTCTCTAAATGCAAAGAG
AAGATCATAAAGAGTAAAGTTTTCGAAGAAGGAAGCCTCATGATCCCCGT
CGCGTCGAGTATGTCGGCAAGTGTCGTGGTTGTCATGGTAATGACGCCTT
TTGATGTCGTTTCTACACGGTTATATAATCAGCCGaaatgATAAAATCCA
ACATAACAAATGAAATATCAA
Run BLAST on NCBI

protein sequence of TCONS_00000074-protein

>TCONS_00000074-protein ID=TCONS_00000074-protein|Name=TCONS_00000074-protein|organism=Clytia hemisphaerica|type=polypeptide|length=242bp
MQAWAECLTGGLAACCACVFSNPLEVVKTRMQLQGELQASGTYKVHYRNF
FHAFYTIGKNDGILALQKGLGLGMTYQFIMNGIRLGTFQQITNAGLTKDD
EGNLSLPKCLIGGAVSGCLGAFVASPSYMLKTQLQAKANTAIAVGTQHDI
QSVSSTLKTIFQNHGITGLWRGASGAMLRVTFGSASQLTAFSKCKEKIIK
SKVFEEGSLMIPVASSMSASVVVVMVMTPFDVVSTRLYNQPK
Run BLAST on NCBI

transcript from alignment at sc0000001:1638892..1649527+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000074 ID=TCONS_00000074|Name=TCONS_00000074|organism=Clytia hemisphaerica|type=transcript|length=10636bp|location=Sequence derived from alignment at sc0000001:1638892..1649527+ (Clytia hemisphaerica)
TAATCATAATAAATGCAAGCTTGGGCAGAATGTTTGACTGGTGGATTAGC AGCTTGCTGTGCTTGTGTTTTCAGCAATCCTTTAGAAGTTGTCAAAACTC GAATGCAACTCCAAGGTGAACTACAGGTGAacatctttcattttttaagc tACTATCTGAGTCATCATGGCATGACCCCCCCCCAGCCCGCAGGGGGGGc tacaaccaaaatcttcctgaaaaaggctggggctggattttttttaaatt tcagggggtacctatgaactctgggggtatctaacttttatgtagtaagg tctgggggcttgggaactatattttatcttgcttttatctaactatcatt attctttttaattgtaaaattatacaattttttcatttcttgacatatac tcaagtcacagggggtacctactaacgtctgttgttagggggtacctaaa attcagggggtacctattttcttagggggtacctaaacccctggtccatg ccatggTCATAACTTGCTCTCAACAGTTTTCATTATTCTTCACATTCTTT CAGTACTTATATtgctacacattttttataagcacctATGTTCTTAAGGG ctcaaatttgccaaatttttcactctctcgtaaagtaaaagctttttaaa taatctaaccatggcaaacgaTACCCCTTGACCCAATTAgcaaaaatttg gtaaaatataAGGGGTGGCCAAAGcaaatctttcagaaaatgagctagaa tgctaagcaaccccagggctgacccgaaaattggagttgcttactTACAA AAAAGTGTGTATAGATTGACTGTCATATTCTTCTTTCCTtcctttaaaac tttttttatcttcctttgttgttttttttcaggctTCCGGAACATACAAA GTACACTACcgaaatttttttcatgcatTTTACACTATTGGAAAGAACGA TGGAATACTTGCATTGCAAAAGGGACTGGGTCTTGGGATGACTTATCAAT TCATTATGAATGGTATAAGACTTGGTAAGTTCTTCATTATCATTTTCact ttgattgaaaatttggaaactaTGAAANNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTT ATAACTTGACAACtacttgaccaaacttaaaaagttataccgcaaaattt aagttagcatgtcctctttctaataaaagtggttttgagtctaaacaaga cttcagtggctcgccaaacgtccaaagttttttctgctgcacccggtata tagtcaaagaagtattgaaccttcaactattcaaaaaatgttataaacaa aaagagacaaaacaataccaacaagaggacacaacaacacaacatgcCCA GGATGAATATTCATAAAATGGAAACTAGGTATGTGATATCAAATGATGAC AAAAGATCTAAACTATTTGTACATAATTCTGATGGAACAGAAAAACAGAA ATGGGACAATGGTGTATTCTTCGGAAGTATCTAAAAAGCAAAAATGCACA GCATGATCTAAATCGACCAAAAGGAAAGAAGCAACTCAATGcgagaaaaa gtaaaaataaacacaaataaaagTGACTCAGTATGAATCAATTTAATATA TTCAAAGAAAACACAAACTCTGTTCTTCAGTTTTCANAATcaattaaata tattcaaagaaaacacaaactctgttcttcagttttcaacctacatagga tttcggccattttcGAAAATATCCTCCCTAATGATATAAACAGGGTATTG TAGATAGGCCTAGCAATGTTGATCAGGCATCACCACAGATGAGGTCGTAA AAATAAAAgtgtttctttgaattattataACGCGCGCAAAAgtataaaaa caaactcaaaCATAAAACCTACGGACCTGCCGAGGATACCAAAAAACTAG CTAGAGAAGTACTACCCACTGGACAAAGTTGCCACATCTTTGACCCGTTC TGCCACTAACGTTGCAGATAATACATTCgaagataaagaaaaaaacactt gaaGTAGACTGCCACCATCTATGACAAGGGAGAAGAAGATTGAAAGGATG GAAAAAAGCatgagaattttttgaaaagttgggtGATAGCCCGGTTCGAT GCCTCTTATCCCCGTGGCCGCTCAGCCCAAAAGCTGGTGAACGACTGCAT TTAAACTGAGTTGAAACCTTGAAAATTCAGAACTGTGACGTGTAATGACT CTACGCAGACTAAGATTGAGTTTACCAACTGTAGCGCCTTGAGCACGCAT TCTTTGAATAAATATGTGGGATTTGTCTCTCAAGTCTTCAAATAAAAGAG TGGATCGAGCTATTCTCAAAAACTCACCAACAAACgaagaataaaaaatg gattCTGGCATATTACTGTCAATGTGAGGCATATGAACAAGAGAAAAAGG AAAGGCATCGCGCTTGTCAAACAACTTGTAAACAAAAACCCCGTCTTTGA TGGAAATGTCAAGGTTAAGGGATGAAGCATGAGATCCTGAGTGTTCAACT TTGAGTTCAAGTTCATCTGGATAGATTTCTCTATATACTGATTCGAACAT GTTCCCATCGTTTACAGCACAGAGATCATCAATGAATCGTTTGGTTGAAT GAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNCtcgatttcctgattttccaattcggaaaaattggattatcgag aaaatttttccgacttggagctctcccgcatttttgcaaggcaaagttga cagctatgcgAGCCTTCACTTTATCTTGTTCAATCAACTGGGTCATATAT CTATGTTCGTATTGATATAAAAACAAGTTAGCCCAAAATGGCGCTGGATC AATGCCCATTGGGATACCTATGACCTGACACATGACAACATTGCCAGCTT TGAAACAACAATTTTTAATCAGATGTTTGACAGCGGTTttcaaagaactt tttgaaaaggaaatAGACGATTTAGGTTTAGTTCTCGACCAGTAAGCTTT GTCGTTCTGGGAGATGGCAATATATTTCGAACCACCTGCATCAAAAACAA AGTCAATAATCCCTGCCAATTCTTTAATAAGTTTGTCATGAGGGATCTTT GTGTAAAGAGTACTGAAGTCAAAGGTGGAAATAGACTTAgcattcttctt tttattgataCGGTTTAAGGACTCCAAAACaggattgaaattttgaagca CCCAAAACTTATTGTAATTACTCAAGAATTTTGACTTTGTGTGAAAATTT TCTATCTGTCgataaatataatatatatttcgTTCTTTCCTGTGCGAACG GCTGCACGGCATTtcggactttaggtgtcgaaccgggttctgggcctact ttctttgttgttgaaaatttgtgttttttgatacttgtcttttgtcgttt gtcttgttcttgtctttttgaacttgtttgttttgtctgttgtttaaccc cttttttgtttctttgtatttgtgtgcgagtttttgttcatttttctatg tttgttagtttgtttggaccgccggtcggttcagggttatggaatctggg ggaggctgagtgttggacgtccttaaaacatgtttaaagccgctgcgcct gtcgcaagtcggggactccagattgcatttgttgggtttttgagtggttt ttggtgtttgtgttNNttatgtctattggtttgttggttctttttcgcat aaaattctcatttcttgacagaatgtttgattggtttgatttatatattt agaaaaattcaaaaaaaatgtaaaaaaacttataattaccttaagggaaa aaACCTTGCGGTTTTTGCGGATTTAGGCCCAAACcgtaaaattaagttcc cgcaaaatttttcaaatgcgaaaaacaaaggtcgaataattcacagtacg gctctaattttcttccaagtgagaaatccgcaaaattaagttcccgcaaa tattaaatattaagtcttgaactgcgaaccgcaaaaattagttcccgcaa aaaatagttctcttaaggtataaaaatattagtccctttttatgtttttt atctttattttatttagtattttcaacactttctctccttgaggtcagcg ttgaaaatactaaataaaataaagatgaaacataaaaagggactaatatt tttataattatacgtttttttacattttttttgaatttttccaaatatat aaatcaaaccaatcaaacattctgtcaagaaatgagaattttatgcgaaa aagaaccaacaaaccaatagacataaagttttaaaagtttatatattttt caaatgtgcgccaaatatgaattggcatctttggtgaaaatttgacttca ttgatgacgtcatcaccaccTGATTATTTTCTGCCCACCAaactgaagct ctaaagggatgtgtggaAATGAATGATCTGGGGAATAAGCTATCTCAATT TTGTATAGACCTCACATTGCTTCAGAGAACTGGGGAACATAGAATGGCTG ATATTGATTCCATTTTAGAATTGTTGAATGAAATGGCATTCCTGTTAATT TACCATAGGAACTTTTCAACAGATTACAAATGCTGGCTTGACGAAAGATG ACGAAGGAAATCTCAGTTTACCCAAATGTTTAATTGGTGGTGCAGTCTCT GGTTGCCTTGGAGCTTTTGTTGCAAGTCCTTCATATATGGTGATTTTTTC TAACTATTCGATATTTTCTCATTTACTTTACCCGCTTAAAAAATgtcttt atttttattgataagTATGAGTGActttatttttaaagaactttttaggT AAAAAGTAAGCTACTGACATCATTAACGACTACTATCTGCGACATTGTGG AGGTCTACGATTCAGACTAGGTCAAAAGTCATTATATCCcaaaacatgtt ttttctttcatttaatTATGTTACCTAGCTCAAAACGCAACTTCAAGCCA AAGCAAACACAGCGATTGCAGTTGGTACACAACACGATATTCAGAGCGTC TCATCAACACTAAAAACCATCTTCCAAAACCACGGTATCACTGGTTTATG GCGCGGTGCTTCCGGTGCAATGTTACGCGTGACGTTTGGGTCAGCCTCCC AGCTAACAGCCTTCTCTAAATGCAAAGAGAAGATCATAAAGAGTAAAGTT TTCGAAGAAGGAAGCCTCATGATCCCCGTCGCGTCGAGTATGTCGGCAAG TGTCGTGGTTGTCATGGTAATGACGCCTTTTGATGTCGTTTCTACACGGT TATATAATCAGCCGGTATGTAAGGAGACTGGAAAAGGTTTAATGTACAAC AATGTCTTTGATGTCTTTCGTAAGATCTTCAAGACGGAAGGTTTTGTTGG ATTCTACAAGGGTCTGGGTCCGCATTACTTTCGTGTGGGACCGCATACAA TTTTAAGTCTTGTCATTTGGGATAAATTTCGACAAATGCTAATGAAGGAA CCTTGATGCACGTTTTATGTTTGTACGTCATTTTCTAGGACAGAAAACCA CTTGTATAGGTATAGGCTAGATAGTCGAGTAGCATGACTTCTTAAATTTA TATTCTTTCGGCTTATTTTGAATGCTCTATTTTTTTAACGAGTATTTAGT TATTGTACATAAAATAGGACCAATTTTAGatcgaaaatattttctttacc CAGTGTCATTAGACCAAAGAAGTTTATAATGTCGCTTAAGAATAAATTGA AGTGGTGAAATCTCTaactcaaaagcctttaaaataaaCGAACTCCTAAA TTAATTTTGCTTAGATCTTTATTAATATGTCATTATCTACCACTTCTACC GAACGTTTTACTAATCAGTGTAATCAGCTTTGTAACGCGAGGCAACGAAC TGTTAAAGCTCGTATttatttaaccctttgagtgccagggtccttttttc taagttttttttaaaaaatcgctagttcaaactttaagggcttatatctc ctgatctagaaggaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNaaaataacgatttctaacacaaactgggcattacagg agggcttcgccctcctatatagcccatgtcgtatatatacgacatcggca cttaaagggttaagttgTTCAATTTCAGCTGTTACtcattctttttttag aaatgATAAAATCCAACATAACAAATGAAATATCAA

Coding sequence (CDS) from alignment at sc0000001:1638892..1649527+

>TCONS_00000074 ID=TCONS_00000074|Name=|organism=Clytia hemisphaerica|type=CDS|length=3645bp|location=Sequence derived from alignment at sc0000001:1638892..1649527+ (Clytia hemisphaerica)
ATGCAAGCTTGGGCAGAATGTTTGACTGGTGGATTAGCAGCTTGCTGTGC
TTGTGTTTTCAGCAATCCTTTAGAAGTTGTCAAAACTCGAATGCAACTCC
AAGGTGAACTACAGgctTCCGGAACATACAAAGTACACTACcgaaatttt
tttcatgcatTTTACACTATTGGAAAGAACGATGGAATACTTGCATTGCA
AAAGGGACTGGGTCTTGGGATGACTTATCAATTCATTATGAATGGTATAA
GACTTGGAACTTTTCAACAGATTACAAATGCTGGCTTGACGAAAGATGAC
GAAGGAAATCTCAGTTTACCCAAATGTTTAATTGGTGGTGCAGTCTCTGG
TTGCCTTGGAGCTTTTGTTGCAAGTCCTTCATATATGCTCAAAACGCAAC
TTCAAGCCAAAGCAAACACAGCGATTGCAGTTGGTACACAACACGATATT
CAGAGCGTCTCATCAACACTAAAAACCATCTTCCAAAACCACGGTATCAC
TGGTTTATGGCGCGGTGCTTCCGGTGCAATGTTACGCGTGACGTTTGGGT
CAGCCTCCCAGCTAACAGCCTTCTCTAAATGCAAAGAGAAGATCATAAAG
AGTAAAGTTTTCGAAGAAGGAAGCCTCATGATCCCCGTCGCGTCGAGTAT
GTCGGCAAGTGTCGTGGTTGTCATGGTAATGACGCCTTTTGATGTCGTTT
CTACACGGTTATATAATCAGCCGaaatgAATGCAAGCTTGGGCAGAATGT
TTGACTGGTGGATTAGCAGCTTGCTGTGCTTGTGTTTTCAGCAATCCTTT
AGAAGTTGTCAAAACTCGAATGCAACTCCAAGGTGAACTACAGgctTCCG
GAACATACAAAGTACACTACcgaaatttttttcatgcatTTTACACTATT
GGAAAGAACGATGGAATACTTGCATTGCAAAAGGGACTGGGTCTTGGGAT
GACTTATCAATTCATTATGAATGGTATAAGACTTGGAACTTTTCAACAGA
TTACAAATGCTGGCTTGACGAAAGATGACGAAGGAAATCTCAGTTTACCC
AAATGTTTAATTGGTGGTGCAGTCTCTGGTTGCCTTGGAGCTTTTGTTGC
AAGTCCTTCATATATGCTCAAAACGCAACTTCAAGCCAAAGCAAACACAG
CGATTGCAGTTGGTACACAACACGATATTCAGAGCGTCTCATCAACACTA
AAAACCATCTTCCAAAACCACGGTATCACTGGTTTATGGCGCGGTGCTTC
CGGTGCAATGTTACGCGTGACGTTTGGGTCAGCCTCCCAGCTAACAGCCT
TCTCTAAATGCAAAGAGAAGATCATAAAGAGTAAAGTTTTCGAAGAAGGA
AGCCTCATGATCCCCGTCGCGTCGAGTATGTCGGCAAGTGTCGTGGTTGT
CATGGTAATGACGCCTTTTGATGTCGTTTCTACACGGTTATATAATCAGC
CGaaatgAATGCAAGCTTGGGCAGAATGTTTGACTGGTGGATTAGCAGCT
TGCTGTGCTTGTGTTTTCAGCAATCCTTTAGAAGTTGTCAAAACTCGAAT
GCAACTCCAAGGTGAACTACAGgctTCCGGAACATACAAAGTACACTACc
gaaatttttttcatgcatTTTACACTATTGGAAAGAACGATGGAATACTT
GCATTGCAAAAGGGACTGGGTCTTGGGATGACTTATCAATTCATTATGAA
TGGTATAAGACTTGGAACTTTTCAACAGATTACAAATGCTGGCTTGACGA
AAGATGACGAAGGAAATCTCAGTTTACCCAAATGTTTAATTGGTGGTGCA
GTCTCTGGTTGCCTTGGAGCTTTTGTTGCAAGTCCTTCATATATGCTCAA
AACGCAACTTCAAGCCAAAGCAAACACAGCGATTGCAGTTGGTACACAAC
ACGATATTCAGAGCGTCTCATCAACACTAAAAACCATCTTCCAAAACCAC
GGTATCACTGGTTTATGGCGCGGTGCTTCCGGTGCAATGTTACGCGTGAC
GTTTGGGTCAGCCTCCCAGCTAACAGCCTTCTCTAAATGCAAAGAGAAGA
TCATAAAGAGTAAAGTTTTCGAAGAAGGAAGCCTCATGATCCCCGTCGCG
TCGAGTATGTCGGCAAGTGTCGTGGTTGTCATGGTAATGACGCCTTTTGA
TGTCGTTTCTACACGGTTATATAATCAGCCGaaatgAATGCAAGCTTGGG
CAGAATGTTTGACTGGTGGATTAGCAGCTTGCTGTGCTTGTGTTTTCAGC
AATCCTTTAGAAGTTGTCAAAACTCGAATGCAACTCCAAGGTGAACTACA
GgctTCCGGAACATACAAAGTACACTACcgaaatttttttcatgcatTTT
ACACTATTGGAAAGAACGATGGAATACTTGCATTGCAAAAGGGACTGGGT
CTTGGGATGACTTATCAATTCATTATGAATGGTATAAGACTTGGAACTTT
TCAACAGATTACAAATGCTGGCTTGACGAAAGATGACGAAGGAAATCTCA
GTTTACCCAAATGTTTAATTGGTGGTGCAGTCTCTGGTTGCCTTGGAGCT
TTTGTTGCAAGTCCTTCATATATGCTCAAAACGCAACTTCAAGCCAAAGC
AAACACAGCGATTGCAGTTGGTACACAACACGATATTCAGAGCGTCTCAT
CAACACTAAAAACCATCTTCCAAAACCACGGTATCACTGGTTTATGGCGC
GGTGCTTCCGGTGCAATGTTACGCGTGACGTTTGGGTCAGCCTCCCAGCT
AACAGCCTTCTCTAAATGCAAAGAGAAGATCATAAAGAGTAAAGTTTTCG
AAGAAGGAAGCCTCATGATCCCCGTCGCGTCGAGTATGTCGGCAAGTGTC
GTGGTTGTCATGGTAATGACGCCTTTTGATGTCGTTTCTACACGGTTATA
TAATCAGCCGaaatgAATGCAAGCTTGGGCAGAATGTTTGACTGGTGGAT
TAGCAGCTTGCTGTGCTTGTGTTTTCAGCAATCCTTTAGAAGTTGTCAAA
ACTCGAATGCAACTCCAAGGTGAACTACAGgctTCCGGAACATACAAAGT
ACACTACcgaaatttttttcatgcatTTTACACTATTGGAAAGAACGATG
GAATACTTGCATTGCAAAAGGGACTGGGTCTTGGGATGACTTATCAATTC
ATTATGAATGGTATAAGACTTGGAACTTTTCAACAGATTACAAATGCTGG
CTTGACGAAAGATGACGAAGGAAATCTCAGTTTACCCAAATGTTTAATTG
GTGGTGCAGTCTCTGGTTGCCTTGGAGCTTTTGTTGCAAGTCCTTCATAT
ATGCTCAAAACGCAACTTCAAGCCAAAGCAAACACAGCGATTGCAGTTGG
TACACAACACGATATTCAGAGCGTCTCATCAACACTAAAAACCATCTTCC
AAAACCACGGTATCACTGGTTTATGGCGCGGTGCTTCCGGTGCAATGTTA
CGCGTGACGTTTGGGTCAGCCTCCCAGCTAACAGCCTTCTCTAAATGCAA
AGAGAAGATCATAAAGAGTAAAGTTTTCGAAGAAGGAAGCCTCATGATCC
CCGTCGCGTCGAGTATGTCGGCAAGTGTCGTGGTTGTCATGGTAATGACG
CCTTTTGATGTCGTTTCTACACGGTTATATAATCAGCCGaaatgA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000038XLOC_000038Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000074-exon-sc0000001-1491911889:1638892..1639017TCONS_00000074-exon-sc0000001-1491911889:1638892..1639017Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1510915933:1638892..1639017TCONS_00000074-exon-sc0000001-1510915933:1638892..1639017Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1575043694:1638892..1639017TCONS_00000074-exon-sc0000001-1575043694:1638892..1639017Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1491911889:1639774..1639915TCONS_00000074-exon-sc0000001-1491911889:1639774..1639915Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1510915933:1639774..1639915TCONS_00000074-exon-sc0000001-1510915933:1639774..1639915Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1575043694:1639774..1639915TCONS_00000074-exon-sc0000001-1575043694:1639774..1639915Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1491911889:1645800..1645930TCONS_00000074-exon-sc0000001-1491911889:1645800..1645930Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1510915933:1645800..1645930TCONS_00000074-exon-sc0000001-1510915933:1645800..1645930Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1575043694:1645800..1645930TCONS_00000074-exon-sc0000001-1575043694:1645800..1645930Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1491911889:1646170..1646505TCONS_00000074-exon-sc0000001-1491911889:1646170..1646505Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1510915933:1646170..1646505TCONS_00000074-exon-sc0000001-1510915933:1646170..1646505Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1575043694:1646170..1646505TCONS_00000074-exon-sc0000001-1575043694:1646170..1646505Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1491911889:1649492..1649527TCONS_00000074-exon-sc0000001-1491911889:1649492..1649527Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1510915933:1649492..1649527TCONS_00000074-exon-sc0000001-1510915933:1649492..1649527Clytia hemisphaericaexon
TCONS_00000074-exon-sc0000001-1575043694:1649492..1649527TCONS_00000074-exon-sc0000001-1575043694:1649492..1649527Clytia hemisphaericaexon
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000074-proteinTCONS_00000074-proteinClytia hemisphaericapolypeptide
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1638892..1649527 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
8.89908 10.8217 7.34722 5.91577 2.54446 2.68047 4.6319 2.01663 6.30862 5.83703 4.74949 4.26003 3.8353 2.71443 4.03865 7.48811 8.47856 9.20562 0.869019 1.38408 3.21905 3.86461 5.95272 6.76941 4.04067 7.90936 1.16947 0.68965 2.07402 2.66028
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR023395Mt_carrier_dom
IPR018108Mitochondrial_sb/sol_carrier
Blast
BLAST of TCONS_00000074 vs. Swiss-Prot (Human)
Match: S2535 (Solute carrier family 25 member 35 OS=Homo sapiens GN=SLC25A35 PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.837e-65
Identity = 125/236 (52.97%), Postives = 159/236 (67.37%), Query Frame = 1
Query:   28 ECLTGGLXXXXXXVFSNPLEVVKTRMQLQGELQASGTYKVHYRNFFHAFYTIGKNDGILALQKGLGLGMTYQFIMNGIRLGTFQQITNAGLTKDDEGNLSLPKCLIGGAVSGCLGAFVASPSYMLKTQLQAKANTAIAVGTQHDIQSVSSTLKTIFQNHGITGLWRGASGAMLRVTFGSASQLTAFSKCKEKIIKSKVFEEGSLMIPXXXXXXXXXXXXXXXTPFDVVSTRLYNQP 735
            + L  GLAAC ACVF+NPLEVVKTRMQLQGELQA GTY+ HYRN FHAF TIGK DG+ ALQKGL   + YQF+MNGIRLGT+      G     EG  S  +    GA++G +GA++ SP YM+KT LQA+A + IAVG Q+  Q +   L  I Q HG+ GLWRGA G + RV  GS++QL  FS  K+ + + ++F   S  + + ++M + + VV+ M PFDV  TRLYNQP
Sbjct:    2 DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFITIGKVDGLAALQKGLAPALLYQFLMNGIRLGTYGLAEAGGYLHTAEGTHSPARSAAAGAMAGVMGAYLGSPIYMVKTHLQAQAASEIAVGHQYKHQGMFQALTEIGQKHGLVGLWRGALGGLPRVIVGSSTQLCTFSSTKDLLSQWEIFPPQSWKLALVAAMMSGIAVVLAMAPFDVACTRLYNQP 237          
The following BLAST results are available for this feature:
BLAST of TCONS_00000074 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
S25351.837e-6552.97Solute carrier family 25 member 35 OS=Homo sapiens... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php