TCONS_00000060 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000060
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length3138

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000060 ID=TCONS_00000060|Name=|organism=Clytia hemisphaerica|type=transcript|length=3138bp
ctattgtttagaaataaccaatcagttaagcatcttgtaaaaactccagc
tcatcccaaattTTGATGAACCTATTATGTAACTCTGGTCCCACTGATCT
TGCTAAATAGGTCACTTGAAACGCAGTTTTAactaaatttgttaaaaata
gCCATAAAAACAACAATCCTGGTTCCTATTACGCAATGCAATATACTACA
ATGTGTTATTTTTGTTCTCCCTTTTTACAAGAAATAGATCATTTCTTAGG
ACAGACTTTGGACCCTCATCAAAAAACATGCAAAACTTTCGATTTATGAA
TTTGCACAAACAGCATTACACATtataaatacttttttgaagcaCATAGT
CTTATTTTAGATCAACATGACAGTCGGTGGATGGAATGGAGTTTCTACTT
TGGATTAATGAGCTGTTTcagatttgaaataattataaatatcaaagttt
tgaaatattgtggtacagtcaactctctctaattcgaacctctataattc
gaatattttttaattcaagaGAGTCAATCGTAGAACTAATTGAAAGGTTT
TTGGATGGTACAACTTGATCGATGCTAACAAAGTTAAACAAACTTAATTA
CCTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAA
TCAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTAC
CTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTT
CGCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGAACG
AACGACTAAACATCCTGAGTAAACAAGGAACGAAAGATACAAACGAAAAT
GGTGATAATCAGAAGGAGACTGATGAATATTTAGTCGGTGGACGAAACAT
GCATTGGTTTCCACTTTCAATTTCCTTTATGGCAACATACATCTCTGCAA
GCTCTTTATTGGGTATTCCAGCGGAGATTTACACATATggttttcaatat
attgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACAT
TTTCATACCGATCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGTATT
TAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATCATG
TCAATTTACATGTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCT
GGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTGA
CTggtctggtctgtattttctaCACAACGATAGGAGGTATCAAAGCAGTT
GTATGGACAGATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGT
CGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATTgggaagatttttg
aaaaagcacAGCAAGGTGAAAGAATACATATTCTAAACTTTGATCCAGAC
CCCCGTATTCGAAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTAC
CATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGG
CTGCCAAATCAATGAAAGAGGCTAGACTAGCATTATTATGGAACTTCCCA
TCAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATATA
TGCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGG
ACAGGAATGACCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGACAT
TTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTT
GAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAG
ACTTCATAAGAAAGATTCGACCAAATATCACCGATACCAATGCCAAGAAA
ATGTCCATGTTACTCGcattttcttcAGGGTTATGTGGCATCGGGTTATC
CTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAG
TGATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGAATG
ATGAATCCATGGTCCAATACCAAGGGTGCATACACAGGCTTTCTGTTCGG
CCTAGGAACCACACTATGGCTGGCAATCGGTGCTATTTTCAATCCACCGA
ATGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTCA
ACGAACGTAACAAATACGATATTGCACGGAAGTGGGATCATCAGACCTAC
AGATCAATATGTCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCATAT
CATACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGT
TCAGTTGCGTCCGCAATCTTTAAACGGATATCACCAAACAATGAAGTGTA
CGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAGA
TCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTT
ACGGATGACACGCAAAAATGGACAAACACCAAATTATCCATTCCTCGTTT
CCAACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTTATCGACTGTCG
TGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGACTCGTATCATCT
AAATCGATTGCATCGCTTAATTTTCTCGTATAAGATGATGATATTTTTCT
TCGTTGATTTTTCGGTGGCGGGCTTGTTCCTCGGGATGAAGTTGTTGAAA
CTTTACGTGAATTTTCCTGGCGTGTTCGGGAGGCGGGGGCGGTCACTTTA
GAGGATTGCAATGTCTTTGGTTTACCAGTGTTGCTTGTTGGTAATTTCGG
TTCAACaattttgattcttttgttAGATCTATTTCCATCTCTCTTCTCAT
GTTTCGAACGTGATAAAAGTTTTCCGAACTTACTAATGACAAATGAGAAA
CAACCATAGCTCTTAAAGCCATCCATCTTTAACATTACATAACTCTGAAA
TAAGCTATAAACTATTTACagatgaagctctttaattctACATCATACTA
TTCCATACGCTCCgttatttgataatatttaaAGTCACCGTTGaaaagaa
actctcataaacgatgctttactattcgataggttcct
Run BLAST on NCBI

protein sequence of TCONS_00000060-protein

>TCONS_00000060-protein ID=TCONS_00000060-protein|Name=TCONS_00000060-protein|organism=Clytia hemisphaerica|type=polypeptide|length=703bp
MLTKLNKLNYLNRNLSILSLSPKQQPIKMSTTSSQFTLSIVDYLVFAIVL
VASSVIGIYFARKGKPASSPSSKEKNERLNILSKQGTKDTNENGDNQKET
DEYLVGGRNMHWFPLSISFMATYISASSLLGIPAEIYTYGFQYIVSCGAL
FVSTFFTWYIFIPIFYRLKIVCANEYLELRFSRGVRNIGCIIMSIYMLIS
LSIGLYGPALAFEAVGGVPLYVSITVTGLVCIFYTTIGGIKAVVWTDCFQ
AFVMIAGLLVVIIIGVEEVGSIGKIFEKAQQGERIHILNFDPDPRIRNTF
WSLIFGVGFTILPAWAVGQQSVQRFQAAKSMKEARLALLWNFPSMLFISL
LAMLAGLVIYAVNADCDVGVYGLHLVDRNDQVLPYFIMQKLGHLTGIPGL
FMAVLFSSALSTVSSSINGLSALLLEDFIRKIRPNITDTNAKKMSMLLAF
SSGLCGIGLSFLISNLGNLVSQISFTVIGTLGSPYLGMFTLGMMNPWSNT
KGAYTGFLFGLGTTLWLAIGAIFNPPNAYPKVVHVDGCAGFNSTNVTNTI
LHGSGIIRPTDQYVPSSSSLASFYSISYLWYGLIGLTVTILFGSVASAIF
KRISPNNEVYVDEKLLFIYKETEDKKITKRDEEREDPVEENHFTDDTQKW
TNTKLSIPRFQRCRLTFESFEVLSTVVEALVVAMYLFPRLVSSKSIASLN
FLV
Run BLAST on NCBI

transcript from alignment at sc0000001:1388762..1409535+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000060 ID=TCONS_00000060|Name=TCONS_00000060|organism=Clytia hemisphaerica|type=transcript|length=20774bp|location=Sequence derived from alignment at sc0000001:1388762..1409535+ (Clytia hemisphaerica)
ctattgtttagaaataaccaatcagttaagcatcttgtaaaaactccagc tcatcccaaattTTGATGAACCTATTATGTAACTCTGGTCCCACTGATCT TGCTAAATAGGTCACTTGAAACGCAGTTTTAactaaatttgttaaaaata gCCATAAAAACAACAATCCTGGTTCCTATTACGCAATGCAATATACTACA ATGTGTTATTTTTGTTCTCCCTTTTTACAAGAAATAGATCATTTCTTAGG ACAGACTTTGGACCCTCATCAAAAAACATGCAAAACTTTCGATTTATGAA TTTGCACAAACAGCATTACACATtataaatacttttttgaagcaCATAGT CTTATTTTAGATCAACATGACAGTCGGTGGATGGAATGGAGTTTCTACTT TGGATTAATGAGCTGTTTcagatttgaaataattataaatatcaaagttt tgaaatattgtggtacagtcaactctctctaattcgaacctctataattc gaatattttttaattcaagaGAGTCAATCGTAGAACTAATTGAAAGGTTT TTGGATGGTACAACTTGATCGATGCTAACAAAGTTAAACAAACTTAATTA CCTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAA TCAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTAC CTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTT CGCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGAACG AACGACTAAACATCCTGAGTAAACAAGGAACGAAAGGTATTTtggaaaat acaatttttttttataagaaccagtaaattttggatCAGACTGGGCTGtt tctaatttttcaggcttattAAGATGCTTATTAgtgtttctttacttaaa atccTTTAATATCTGTACTCAGATTATTATAGcatcttataaaattattc ttatgaaaaagcgTGTACCTTAATTTCCTTAATTTTCGCGCGCTTTTTAT TTTCGCGCCTCTAATTTTCGCGCCTTTCATTTTCGTGCAGCTCGTAAAAT AGAATATTCGCGCatcctttaattttcgcgcattttGCAATTTCTGGGAT ACTTTCTGAGTGTTTTTGACGATTTTAAGTGAGTTTTACTCACTTTCAGT GTGTATTCAAGCTAGATTTTACATCCCAGATGCATATTTACCATGAATCG AGGTcctattttattaaaaaagtcaTAAGATGAGATTTCCACACGTTCAG AACGATTACTAGTTCGCGcaccctttaattttcgcgcggCCAAGTGCGCG AAAATAGGCCTATTACAAATAACCTATTTACATAACTACTATTTACCCTA CAACAGATGTTGTGGGGGCCCCTCTCCCGATGCATAGTTAACTTGAAATA TCATCTCGTTTATTTCaatattcattaaactcacaATACTACTATGAAAT TTACTGTAATTTTCAGAATCCCCTCTGCTAGAACCCTAGGTTTCTGAGCC AATTAAATTTACTGGTTGAACTGTTAAATGAGACAGGAGTGTGCCCGAGC AATCTGTCCAAGAAGTGCTGACTTAAGCGTGGAGTAGCCATGATTAGAAA AGTTCAGAATATGACGTAGCCGGTAGGCGACCGTAGTGCAAAAGTAAAGC ATCCGGCTACGGGTTCACTACCCGGCAAAGTCATACCAAAGTGCTTCTAA GTTCTTAGTACAACATTGTACTATATAGCTATCATAAGTGGAACTTTCAA GTCACCTCCGAATGTGGGTACAGACTTTATCTTGAGCGCCGCCTATTTCT ATTATTAGATACAAACGAAAATGGTGATAATCAGAAGGAGACTGATGAAT ATTTAGTCGGTGGACGAAACATGCATTGGTTTCCACTTTCAATTTCCTTT ATGGCAACATACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGAT TTACACATATggttttcaatatattgtctcTTGTGGTGCACTGTTTGTCT CAACCTTTTTCACTTGGTACATTTTCATACCGATCTTCTACAGACTGAAA ATTGTGTGTGCGAATGAGGTAGGTTGTCAATATATTTAGCTGACAGTCAT TGAAATTCGTTCAACctagtatctacggctaatttcaaaatgccgtagag ggtctgttgtcattgtttttctcattatttgagatttttcaaacctacCG CtccgatggagtgttggtgagagaggggagatgATGAGAGAAGTGTGGCt atttaaaaatcatacttcatcgcagaggtttctgtatgggaattttttta tcaaacagataATGCGCACAGAGTGGTTCTACAAAGCGATAAAAAGTGAA ATAGGTAGATCGCTAGTCACGTGATTTACCCCAGGACAAGGGATCAAATC GAGCCTTTTAccattcatgatatgcaccattgcaatgttttctaacatta catcacggacctaACAGCTgatgattggttgcaagtgacgtattgactga ttttacgccactaacaaccaatcagctgttgggtctatgGTGTGATGTCG AAGACAATGCAGTTATGCGCTTCATTGATACTCCCCCTGAACAATATACT TTCTAACCTTATGtacaattttttcttgaaaagcttATTGTTAGATTAGC CAACTTTCTCATtggcgagattatgtatcggagatattctactgctacgg ttgcggggctgcccatgcgggtcgtcaccaaaggcgacatgtcgttgtct actttgctctgtacgggaaaacaccaaaacaccgtataagcaaagtcaac ataatgccgtacgtcaaatatcgaacttgctttcacccgccattacttgc attactcgccatttccctcgccgctttaaccgtagccgtagagaattcca gatacataatctcgctattatGAATATCTATACCCCAgttctttataaaa aataaaaaatccgcaatttcatcaattttttgaagaaataatttcaaatg GGAGACAAACCTCAATTATGAAATGGTCAACCTCGTTCCCATTGCATTAT TAAACATCATCTACTCTGATGGCGCTAGAATATATTCTCTAATGTCAATC GGTAATGtgaataaagcctgggatacacggggacgaggctGTGAAATAAA TTGTTTAATACTTCTTTAAGAAACTTCTTACTTAATTTTACTTAATCAGT ATTTAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATC ATGTCAATTTACATGGTAGGTAAATTTAGAATGTTCTCTGGctgaaattg aaataattagTCTGTATCGCAGACTTTTATAGATATATTTCCTctaagaa actcttttcgctTAGAAGATTcatgagcagaagcctataaAGTAATTGAA TATCAAATGTCTACTCCAAACAACTCTTCTCATTCACAGACCCACTAGAA CCgcttcccactggaaaagttgGCCAAAAAATATCATCCTCAGTGGAAAG TTATACTCCAAATtgtgtccccactgaaaataataaaataaaccaatcct aaAATACATGTAGTAATATGTTATTTTTCCCATCGCGATCCCCACTGAAA TTTCTAAATCCCCGAATATCAATTCTCATCGAgcttcagtccgttatttt caccccactttctgaaaaatcctactgggtctgtgagaagggggtgtctc cCAATCTGTGTCAGAGACAAGCAATAATTTTCTTGCCTGTAGGATTAAAA TTAATGACCAAAGGGAATATGAATTTCCTTTGCTTCTATTGGATAAGGCT AGTGAAATTCAATATATTCTTGACGAACGTTTTTTCGGCCAAATTCTGCA GTGTGAAATATTTGGCAGCAGTGTTTTCCCaggttttttaatattttttg cacaaaaatcCTTTGTCTTTTATTTCGGTGGAGGTATACTGCCAAAATAT AGATGGTATTCGTTTTCTTTTCATATTGTTCAGTTGATTAGCTTGTCGAT CGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGGTACGAAATATTTGA TGTGTTTAAGAGTTTTCCATAGTGAATATAGATAAAAGATTGCTTTCTCG GGATTTCCAAACCAATCAAAATTATGTGCCCTGGCGATCAAAGCGTCCCG CTTAATCCATCGCCAATCAAATTTATACAAAACACTGGATTTAGCAAACT TTTTTTCATCGccaattttcaggattttcagaCTTCTGTCATATACTTTT TCTTCTCATTTTCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTG ACTggtctggtctgtattttctaCACAACGATAGTAAGTTTTCTTCGTTG TTTAAAGGTGGGATAGTGGtctttatttacaaaaagtcACTGGGCGAAAA GTGGAATTTCCAGTATAATGCAAGATCccaaaaaaaagatcaaaaaagac ctggaaatgttatattttaaaaactttccggtctaatggaaattgtttta atcttttcaaaaattagaaaatcagaCTCCCAAAAACTTTGGAATGTGAC TTTTATTTCAGGAACATTTCGTGAAAcatgatattttcaagtttttttaa atatttgtaACACCAATAcgctttcttagaaaaatccctaggCAAGTGAT GATGTTTTCCCTGGCGAAAAACCATCCTGGTAAACTCCAAGGAAGTTATG CCAAAGTCTGTCACAAAAGTTACCAAGTTTTACCCGACGAAAAGTTTTAC CCAACTAAGTTTTCCTCTTTAAGGGTATTAAAACATCAAATGTAATAAAA ACGTGTGAATTTTTCTATTAACAGGGAGGTATCAAAGCAGTTGTATGGAC AGATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTCGTTATCA TCATCGGGGTGGAAGAGGTCGGGAGTATTgggaagatttttgaaaaagca cAGCAAGGTGAAAGAATACATATTCTAAAGTAGGTAGCTctcagtgaatt ttttttaagtctAGTGAGTCTTTCCATGAACTTCTAACGACTGGACGGAG AACtcattgtttcaaaaacaaagcgCGGCTTTTTCCTTTTTGCAGAGAGC GCGTTGCcgccaaaaaattgaattttgNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTCA TACTGTAACATTgttgtcaaactaaaaataatgaatttttgttCTATTTT ACAGGATGGCTATAAAAAGATTGGAAACAGATTGGGCGAAACATTGTCCA AGCTTTAACGTAGCTACGGACTACAAACGTAAACCATGCTGGAGATAACA TTTTAAGAGATGCAACCATTTGAATCAATCGGCAAATCTATGtatttatt tggaaaatttgtcgTTGAACCCGTTTGATGacgttttgaaaatattaaca ttttaatgccattttttaaaagtttaaatggATGCAATCTATAATCAAAC AATAAAGTTCAGATCTACAGCATCATGTGTCATGCCCTTATAAGAGACAC ATGAACCGTTACAGTAAACATCAATAGTTGACAACAAAAGACTAACTGGG GTGGACAAATGATGTGTGGTTATTTTTCTGGTATTTGTGGTATATATACA TTGATAGATTTCTGATGGAATTACagtaattttttacattttgctttcaa attttctgCTCTTTAGAATGAATTTGCACACTGtatatactttaatcgga ttaattttcgcgtgattaaatttcgcgatttcgcgaatttttgccatttt cgcgaaattaaaactcgcatacacgcgtgagattcctggttcgcgaaatt aaatccaaaacttttaaaattgtatttttggcggagaaactagttccaag tctccatttttggcaaaaaatgcctattttcagctgttttctggcttatt cgcgaaattaaatccacgcaaaatatttcaaaactctgactcacgaaatt aaatccagaaaatttcgcgatttttttagctcgcgaaatttaatctcaca aaatttaatccggttaaagtaatAACTGATTCCCTCACTGATACAAGAaa ttatgattttatttttcatatatatTTTATCAGACCTTATattaatttct taaaatttacttcaattttttgaagtttttaaatgAGCATTTGCAGGATA TTTTGCACTTAGACctcaatttgaaaattatttaatgNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNCCTTTCTTAACCGAAATACCACctcaaaattaaagtaaaa tttaaatACATTCAGCAGAATGTCAGCACTGTTGTTTTGGACtccaatat ttttataaagcttttaaaattAATCTTTGTTTCAGTCTAATAAATTAAAA TCATCCTAATTAcagtagaaaaaagttttcattaccAAAAATAACATaag taaaattcaatcaaaattgttgaaataaaatttctaaataaaaattgatt tttgccaCTACATTCCAGAGTCACTGCCAATTTATGTTCACGTAAAATTT TGGTCATTGTGCAGCTATGACCTTACCATCGCTGGGAGTGTCAATATTGT CAgcaaacaaaataacaaaaaagctgACCATCATTCCATTGCAGTCTTTC ANTCGTAAATACATGTAATTCATCTTTCTTGACATCAGCATCTCTCATCT GCTCCTCATACAAATCCCGTTCAGTGAATAAATGTTAGTCGTGGATATAA CCATTTTCTGTTGTTGACACCACAGAATGAGAatcctaaaaatgtaaaaa aaatgtactctttaaaaaaagcaattttgacAAGGTATAtattatttaat tttctatACATTTGAGTGAAGGACAGTGAAGGTAGTAGGGTAGTAGTTCT TCGAAAGCTTATTTGCTAAATTGTTTCCTGTACTATCAGTAATGTATAAG AGGGAAGATttgtgaaaatcaaaaaaaatttaatgattttagtTAGAGAG TCGAAGAAACCTCATCAGCCTGTCAGCATTCTCATTCAACATACTTTTCC CTCTCTTTTCGtagaaaaaacaaataaatattcaaCTCCTACCTTTATAT TTGGATGTGAATCTGTATTTAAAAGATTGCCAATATATATTGtcgatatt ttgatgaaaaagcttgtaaaagtcaaaaatttccacTTCACACTGATGGT GGGAGAGTGCTTTCgaaaaagattgtttttttgcCCGACATTCATACAAA TCACAACAACTGGGTTATCGAGACCTCGACTTTTTCTGATGCAATATCAC GTGAACAGAACGTCATCATCCTATTTATTTGAAACAATGAAAGAGGTGTA TCTCCTTTGAAGTCAATTCAAATGATATGAAATAAgattagaaaattttt cactaaaaaaccCTTGGGTAGTGCAACGTGGAGACAGGTTGGACAAGCGA ATCAAAAGAATAAGGTTTAGTAGCAATAGTAGCAAGtaccttaacccttt aagtgccgatgtcgtatatatacgacatgggctatataggagggcgaagc cctcctgtaatgcccagtttgatttAGAAATCGTTANNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN CTAATTCATTCTAGATCagaagatataagcccttaaagtttgaactagca atttttaaaaaaaaacttagaaaaaaggaccctggcactcaaagggttaa caaAAACCGGGACTTTTATTCCGTTTCTTGGTGAGTTCCACAACTTTgat gacttttgaaaaatagaagccttccAAGTGTATTGAcgcaattttaattt tttcggtactgcaggagcttcgaaagctaaaagtgacgtcaaaaaatcga atttttagATAGATAGTCTCccaacattcgaaaaagtcgcaaagtggaaa agacgttaattgcgtagaaaaaaacgCTGGTAACGTCTAGTATAGGTTAC AAGTACCTCACCAATAACCGGGACTTTTTATTCCGTTTCTTGGTGAGTTa cactttgatgatttttggtaaaaagaagcctttcaagtgtatTGACGCAA ATTCCGAAGACCTACGCTccaaactttcgaaaaagtcgcaaagtggaaaa AAGCCATTACCAGAGGCGTATTTAGGGTAGGTCAAGTAGGTCAAGTGACA TAGTTccgagaaattgaaaaacatgaaaaattgtGAAACAGGCAATCTTA TTCCTCTTAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGCTATTTAGagact tttattttgataatccgAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNTGACTTAGCAACACCCTTTTTGACCTCTTTCGCCCTAGCAAATCGGG ATCATATTATTACCGAGCTCAACTTCTCTAAAAATTCACGTGTAATGACC TTGAGTAACTGCTTATATATCTGGCCGCCTTTCATTTAGAGATAATATGA AGCCGAGAGACATAGCTAGAAATGGCTGAAACGACCtagcaaaatttcta aaaaaatcggGGTAATAGCTATGAGGCTACGTACAGCTTCTCTGTCgagt ttattaaaaaacaatacTCAATTCACATTTCCTAGCTTATCTCTTTCACA GTTTTTATTGAGAGAAGCTCAGTTTCCAGAGCTGAAATTTGCTGAAGCGA CCCAGTTAACTTTTgagtttgatctgaaattttgtgaaagtcCAAGTAAC TTTCACGTCTTAACTGTGATTTTATAGCTTTAATTCTTATGGATCGATTG CTAAGAATTGATCGTCATGATATTAAGCATCAGCACCAGTTGTCACTGCT TTAAGTTGAACtaataatgtttattttttaacaaaaatgaagcatttttc aaagtcttttaaaactttgtttttttcctGCTTTTTGGTTGTTGTTGTGA GCGGAAATGAATATATTAGAATGATTTGACACCATTTAATTACcttatat tcaattcaaaacataaaaaataattttggggaTATAAAGGCCTATAAACT CAACTATAACTCATCTATATTTCTTGTTTTGGGGAAACGAACATTGCTCC ACATCAGTATctatttttttaccacaagcggTTAANNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTT CCAGCTTTGATCCAGACCCCCGTATTCGAAACACTTTTTGGTCACTAATC TTTGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCAACAATC TGTTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGACTGTAAG TTTTAAGAACAAGAGGTTCTTGTATGGAGGCAACCGGGGGACGCCCTGTA TCCTAGGCTTTATTTGCGTTACTGATAGACGAATACCCCGGTGTTGGTTG ATGCGAGGACCCTCTCTAAAAGGGGGAACTTCTCAATACACCCCTATATC ACAGCCCTGGccgaacttttttcctcaatggggataaaaattcctactga aatcccaatggggatagaaattctattgttccaaggtttaaAATACAGTA AGATGGTTTTAGAGTCCAAtatttaaacattgaatttcgagtggggatga aatcaattAATcgggactgattgcgcctccataaaCAGCTTCCCGTTCGT TCGAAGCAAAAACATCCTAAATCATCGACCAGTGGAAAGTCGTTGTCAGA TTGCAGTGGTTCTGATTAACCGTGATTCCTTTCGaatgtgaaatggccta tgatATATCATGTCAATGGTTTGAAAAAAGCGACCGTAGCATGGAGGAAG AGCATCCAACTACAGTGTGCAAGGCTGTGGGTTCGATCACCAGCTGAATC ATACCAACAAAGATTCACAAAatagtacttgatgcctctctgcttgatgc tcagcaattaaagagacGAATCAAGGGTAAATGAAGAAACCCAGGGAACA GAGTGGTGCCCTCCTCTACCTTCGGGTAGGAAGTTTgggaaaagggagcc ttcgggtcgccctcgactgcggttgCAAACTTTACTTGCTTTATTACTTA TGGTTTCAAAATCAAGAAAGCAAATGAAATCTTATTTTGGATTTTGTAAT CTTTTGTATTCCACAACAAGACAGGGTATTTCAATCAAAGAGCTTATAAT ACGCAGGTAACGCGGCTGGTATAGAGGTATCTGTATTGTAGTAGCAGAGA CCTTAACACATCATGACACAAACCGCTTAAGGCGTCTGTGCAAACTCATC ATTCACAATTTTGTAGTACCATTGTATAAGTCCTTAAGTTGAAATTACAG ATCTTTATTTAGAGCATTATTATGGAACTTCCCATCAATGTTGTTTATCT CATTGCTGGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGAT TGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATGACCAGGt agaaaagaaatgtttttgaaaactgTTAACCACACATTTATCATATTACT TTTCATACTGAATgatgataaaattgaaaatgaaagaagaaaacatagaa aattatATCCTTTGGTGCTAGAATCATCTTTGGTACAGAGATACTttaaa ccattgagtttaaatcccgaagggctagagtagaatctctaacctttcca aGGCAAGACAAAGTGAAGCCACTCATTTCCCACCCAGAGCGCGCCTAGAa tgcgccgtaatcatgacaacggattgtatctagcggctcctttatttttg aggactgcattttttgaatctAGCGATagtttgtatgaaaaccacgcgcg ggcgttctggatgggaaataagtgattTCAGGGTAggtagaaaacctggc ccacctctctggcccgggccatatggcctacccttggcccaccctttggc ccaccttcaaacattttttcccCCGATTTTATTCTCGGACAACCAGGTTA TAATGATATGTGTGCGTCGGTATGCGCTATATTTCATTATGATTTCATCA TAAAGCGCGTTGGCGTTATTGCATCAGTCGTTTTACGACAAACAATTGGT CAAATCTTCTAAATGCTCTAAGAattaaacgcttttttttataagaatag tgtactttggatgagaggGTCAATTATTCTTaggaaagtgccaaaattga gggtgaaatattcttaacgtaggTCTTGTCTATCTGACCAAGGGCTAAGT CCCTTAAAATTTTTAAGCTATGTCAACAGAAGTCAGCCTAATGGTAGCAC AATGTGCTCATGCACTAGGGATCCCAAGTTCGAGTCGGGTTCGGGTCAAC GTCAAAGTTTTTCGCCATGTTTTGAaactttatgtttttttgggtgaaga ttccgaaaaaaggggaccgaagtcctgaaaagttgaagaGCGCTACAGGG GTTGTTGGCACCCGTACAGGACTTAACCAGACCCTCTCCCGGGGGTCCCC TTAATCTATGTCAGGTGTATAGCTGTATAAAATGCagactttttagtttt ttttgtttatttcagtctcgttgttttttaaaaatgccagaaaaaccAAA GTCCAACCTCAGAATtggtttgcagattttcagaatgataagaatcaaat cttttttagagttgcaaggtgggccaaagggtaggccaagggtaggccat atggcccgggccagagaggtgggccaggttttctaccTACCCGTGATTTC ATTTCTCTttcaggagtctcgagtctagccgtctggcttggaagtcaatg ctTTAAGCCCTCTTGATTTCagaattgaaagcaaaattgCGGACTACTTA GCTCTATCAAGTGGCTAgattgtcaaaatattttgggtgttttgattttt gtttttgttcgcAGGCGAACAATATAGGGATTAGGATTTTGTACCAGAAA AAGTGTAATATCTTATGGACATTTTATGTCAATCAACAATTGAAAAAAGA TCTGAAGATCTGGTAATAGCAGCCTTGTTTACTTAGCTAAATGCTTATGC TATACATAGAAATCACCGTAATCCAGGGGGGATGGTACCCCAGTGAAGAA TAATATTCTGCTACAAGTCGATTCATCTCAGAAAGTCTGATTGACTAATT TCTACTTACAATGCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGAC ATTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCT TTGAGGTAAGTTTTCttcgaattttttcttttcaaattaataTTGAATCT TTTGTTATAAAAATCTTTGCCACTATGTATTTCATTTTATACGGAAGTAC CCAAAAGTTTAGTAGTTCTCTATCAAACTGAGATCAATGCGCACATATAC ACGTGTTGGCACTAAATGGTAAGTCCTTGATATTGATATCGTTGGGTACC CAAAAGAGAACCGGAcgtttgccactaattttgaatttaaacaataaaac tatGGCAAACACCCGGGTTATTTCAGGTTTCAGGTGCTTCCGTTTAAAAC ATTACGTCGTGAGCTCTATTCAAAGTATTGACATTGGATTATCAAATCTA TAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAG ACTTCATAAGAAAGATTCGACCAAATATCACCGATACCAATGCCAAGAAA ATGTCCATGTTACTCGGTAAGTTTTACTTAAACGTTTTCTTTATAACAAT AaattatacagggtgtcccggaAAAAGGTCCTGTTTTAGAACACTTTCTA TGTGATCGTATTTTGGAACACGCTAATATTAACTTTTGACATACAAACAC AAATTTCTTTCACTTGTTGTCGTGCTCTGAAACAGAATTTTTTGTacagg acaccctgtataataaCATAAGGTAAGGCTTCTATGGCCGaattattaaa aacaagttaagatcGTTTTAAGGCTTTcccaaaatggtaaaaataagaac actttaaaaacatttttaggcttcaaactcaaaattCGTGCGATCTAAAG GTGCGGTTATTGGTTATTGTCAATATGTTTcaaataaactttgtttttgt ttttcagcattttcttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCAT CTCAAATCTTGGGAACCTTGTCTCCCAGGTACTTTTTTATCGTCACAGTT TTGTATTACAATCATTCGATACACCTCTGACCTGGTGACCTGATAACATG TTTAAATATGAGGGGTATTTTATTGTTACTCAGAAATCCAGTTAAGGTTT TCTCAAAATTGCAGTGACTATCCCAGTGGGGAAGACAGTTCAGTAAGTTT CGCAATGCAATAGGgataaaatttgagaatattaaattttttcaccAGGG ATGATTCACTAACAATTCTTTCAGTGGGAACATGGTGGGAAGGGTGTCCT ACTATAATAATAGTTTTCTTATTCCTGTTAAGTTTCACACCTACCTGTTT TTTCCCCAATTTAATGTTTAGTGCAATTTTTGTCGATTTATCATACGCAA GCCCATTTGAGTTACCCCAGcgtatttataattttttcatcaGATCTCGT TCACAGTGATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACCTTG GGAATGATGAATCCATGGTCCAATACCAAGGTAATGACCACgaataaaac aaaaaactcaCAAAACGTCTATACCTTTCTTTATTTggaaaaactttaga aaaacattttgcttaCTGGTCGATGACCAATACATCGTCAGATATGATTT TAACCTTGCTGGTAAACTCGAATCAAGGCcggttttttaaagattctgat agcgctctgGAAAGGTATTGTGCCTACACTACGTCCAtcaataaagtcaa aaagtggtgcaagtaGCTCTGGATACGAGATTGCCCTGCTGATGGGCAAA GAAAGGCTTCAACCTAACAACTCATGAataaaataatacttttttctTGA TACCCCAAACTAATTTCAGTCGCCTCGCCTTTACGTTTACCCCTGTCTTG GTAACACTTTCTCAGAACAGTGAAGAATTCTCTGAAAATCATTTTTGTCT CTGAATATTGTATAACATCAAATCACTTTTCTTTCCTTCAGGGTGCATAC ACAGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCAATCGGTGC TATTTTCAATCCACCGAATGCTTACCCAAAAGTAGTACACGTGGATGGCT GTGCAGGGTTTAATTCAACGAACGTAACAAATACGATATTGCACGGAAGT GGGATCATCAGACCTACAGATCAATATGTCCCCTCTTCGTAAGTGTGAAA ATATCGCCCAATAAAACGGCCTTCAACAAAGACAGAGGAAAGATCCAATG AGAGTTCACCTCGATATTTTGATTAAGTTGACGATGACGAAATGTAATTT TTCAATACAcgcttcttttataagaatagtttgTTTTGggtgagggtcaa gtattcctaagagattgcaaaaattgagggtgcaatattcttaacatatt cttattctTATAGACTTGACTTTAATGCAAACATGAAAAATGATCAGTTT GAGAGATTGGGACTTTTGAGTGCACATTGGGagctaaaattatatttctg cctcaaagttttaaTTTAAGCCTAACAAAAGAAGCACTTTTTTGGGTTAA CcgaatacaaaatgactgtattcagTATGTCTCAAAAAGGGGGACAAATT TCTATAAAGTAAATTCCTCAAAAATTTTATGACTAGATTAAACAGAGAAT TTTAATCTTAATTCAATTATTCCAAACCCAGttttgagttttgaggattt tacttacTGAccgctttttttgggacacaatTTGTAATAATTCTGAAATC TTGCATACCCTCCTCTAGGTCATCTTTGGCATCATTTTATTCCATATCAT ACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTTCA GTTGCGTCCGCAATCTTTAAACGtaagaagtaaaaattttgtcAAACGTG GATTTTGCTTTATATCAAAAAAGTTCTAATATAGACTACCATCGTGTAcc agaaaaaagtccccctCTTTGATGTGAAGTTTCTTGAGTTCTATGAACTT TTAAAGAATCAATTCTTTTGCATTGGAAAACCATAGGATGAATATAAATT TTGAGGtgtcaaatttggtcaactagatcaaaagttatggccttATTAAA GGCGAAACAaggacttttttcttgaaatctCAGTACCTTGTCTGATTCAT TTAGGACCTTTACACAAAGTTCCAAGCCCATAAATTTTCATCTCACGCCA AAGAGGACAAATtgttaaattgaaaatttgacaacGTAACTTTGTCTAGC AGACGAATCTCAGACAAGAAAATAATGAAAGAGACAAATTATAGTCGTCC AGAATGTCTGCATACATACAAACTGATTATTCCGTAATAATTATGATACT ATCATATTACACACGTATTACCGTTCATTACACAGATTATAAGTAGCTTC AGTCTACAGTCTTActaaaataaagtaaaataaatttttctacttATAAA GTCGTGCTCTAACACAGGATTTTTtccgggacaccctgtattatgAGGAC TTTTACTTTATATGAAAAATCATCcgctttttttcgggacacatTGTAAA TATCACtttgttattactttttttcGAAGGGATATCACCAAACAATGAAG TGTACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAG AAGATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCA TTTTACGGTACTTCAAGAAATAGGTTCATATTCATAACGTAATTTCTTTG TGGAAACAACTCGGCTTTTGCCAATTTGCCTTTAATATGATTCATGCATC TGTTACATGCTTTTTTTCCTATTCATTTTATAGGAGGAAAATGCACAACC CTATGCAGATTTCCCTCCAAGAAATCCGTGTCGTTTTCCAATCGGCATAA AATGTCATatttatccccccccccccccccaaNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCC CGAGTCATGAGAGAACAGATCAAACATGACTTGAAATCTTTACAGAATTT TAACGTGTTAGTGTCtgactttttgacaaaaagagTAGTTCATTGTTAGC ATATCTAGTAAACGCATACCTAACAACTTAATGCAAGAAAAAGTAGGAAT CGGCAAAGGCAATATCAAAGgatgattaatttttttcactttcatgAGAA TTTATTTGGTTGCCAtttatccaagatcttggatatGATTACCATAGTTA CTTTTATTATCGCATAATACCCGTCTCATAGAATTGTGATTTGTCATCAC AGGTCGTATTTCTATATTTAAAACTAAAATTAGGTTTACACCTTTACACC ATAATAATGTGGAAAATTGTTTCTACCATTTAGGATGACACGCAAAAATG GACAAACACCAAATTGTAAGAAGATGACACATGACATTTTAGAATACCTT AATGACcttttttacaccggcccttatcgGTGTTATTTTtaggctcgtgg cgtaataagggccggcgtaaaagggacTGGttttaaattagggccggcgt aaaaagggccgataaggtaacaTTGAAAGACGTGCACCACTTCAGGAAAA AGACGTTTTATAAGGGAGCGtctccaaatattgtttcatttttaaacgaa aatgaaacgaaTGCTTCGTTTATGTTTCGTTTCGACTTCGTTTCGACTTC GTTTCAGATAATGATGTCTGATTAATTTTAATTACTTAAGAAAACAAGat aattgaactgaaaaaaagagaatattttgaaacgaatggtaaacgaaata aaatttttctctgaacTTCATATAATTTCCATGTCATCCAAAGCTTTTTA GAACTTTTAGCAATAGCCTGATTTTGTTACTGCAACAATAGATAGTTCTT ACTTCCTCAAAatgtgtaatatttttttcgatgtttaaagggattcagtt tctgaagtttcttgctttcaaGCTTAACAAGTTTTCTAATATCTTTTGGC GTAGATTTAAGAATTCTTTTAAACCTGGTTCTGATAANATGATAGAAGGC TGAGAAAGGAGGATCAAGAAGATCATACTTTCCGACATAACAACCCGAAA CACTCTGCAAATTACTTCAATATAATTCATACGGGAATACTGTAGTTAAT TACACCTGATTTGGTAATTAATTACAAATTGAGTCGGTAACACCGTCATG ACCTGTTAAAATTGTTGCACTAATTATATCCCTGTTAAGATAGCCCCGAA CaataagaaaaacatatttaagAAAAGTCTACATCATAAAATACGAAAGC AGACTAATTTGGATTGATCTTCAACCAAATCCTTCTGTTGaaaataaagt atatgcttttGTGAAATTAAACATGAACTCTTTGTCCTATCCGTTTCACA AAGTTTTAAGTGAGAAATTTCTCCAAACGAAATGAAACGAAATAGAAAAA ACTTAGAGATAATATTAGATAATTATCTCTAAATTAGAACTAATTATGCA TTTCGTTTGAGCTTCGTTTGAGCTTCGTTTTAATTCGTttcatgaaacaa tttgaaacgaaaaaattgaaacaatatttggagaCGCTCCCTAATATTAT GTATTTTTGATATGGTACTCTATAGAAGGAAATGAAATTTATACTAATAA TTTGTacataaaaaaattactaaatacACCTGAAGTCCATTTGCTTTAAG TCAACCATAGATAATAAATGTCAGCAAAACTATTTCGTTGTACCTATCTC ATGTTTTTTTTCGTTGATCAGATCCATTCCTCGTTTCCAACGTTGTCGAT TGACATTCGAATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTG GTTGCGATGTATCTATTTCCTCGACTCGTATCATCTAAATCGATTGCATC GCTTAATTTTCTCGTATAAGATGATGATATTTTTCTTCGTTGATTTTTCG GTGGCGGGCTTGTTCCTCGGGATGAAGTTGTTGAAACTTTACGTGAATTT TCCTGGCGTGTTCGGGAGGCGGGGGCGGTCACTTTAGAGGATTGCAATGT CTTTGGTTTACCAGTGTTGCTTGTTGGTAATTTCGGTTCAACaattttga ttcttttgttAGATCTATTTCCATCTCTCTTCTCATGTTTCGAACGTGAT AAAAGTTTTCCGAACTTACTAATGACAAATGAGAAACAACCATAGCTCTT AAAGCCATCCATCTTTAACATTACATAACTCTGAAATAAGCTATAAACTA TTTACagatgaagctctttaattctACATCATACTATTCCATACGCTCCg ttatttgataatatttaaAGTCACCGTTGaaaagaaactctcataaacga tgctttactattcgataggttcct

Coding sequence (CDS) from alignment at sc0000001:1388762..1409535+

>TCONS_00000060 ID=TCONS_00000060|Name=|organism=Clytia hemisphaerica|type=CDS|length=35904bp|location=Sequence derived from alignment at sc0000001:1388762..1409535+ (Clytia hemisphaerica)
ATGCTAACAAAGTTAAACAAACTTAATTACCTTAATCGTAATCTGAGCAT
ACTTTCCTTATCACCAAAGCAGCAGCCAATCAAAATGTCCACAACGTCGT
CACAGTTCACACTTTCAATTGTTGACTACCTCGTCTTTGCGATCGTCTTG
GTGGCGTCTAGTGTCATTGGGATCTATTTCGCTCGTAAAGGCAAACCCGC
ATCATCACCATCATCGAAAGAGAAGAACGAACGACTAAACATCCTGAGTA
AACAAGGAACGAAAGATACAAACGAAAATGGTGATAATCAGAAGGAGACT
GATGAATATTTAGTCGGTGGACGAAACATGCATTGGTTTCCACTTTCAAT
TTCCTTTATGGCAACATACATCTCTGCAAGCTCTTTATTGGGTATTCCAG
CGGAGATTTACACATATggttttcaatatattgtctcTTGTGGTGCACTG
TTTGTCTCAACCTTTTTCACTTGGTACATTTTCATACCGATCTTCTACAG
ACTGAAAATTGTGTGTGCGAATGAGTATTTAGAATTACGATTTTCAAGAG
GTGTTCGAAATATCGGCTGCATCATCATGTCAATTTACATGTTGATTAGC
TTGTCGATCGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGG
TGTTCCACTTTACGTATCTATTACAGTGACTggtctggtctgtattttct
aCACAACGATAGGAGGTATCAAAGCAGTTGTATGGACAGATTGTTTTCAA
GCATTCGTAATGATCGCAGGTCTACTCGTCGTTATCATCATCGGGGTGGA
AGAGGTCGGGAGTATTgggaagatttttgaaaaagcacAGCAAGGTGAAA
GAATACATATTCTAAACTTTGATCCAGACCCCCGTATTCGAAACACTTTT
TGGTCACTAATCTTTGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGT
CGGTCAACAATCTGTTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGG
CTAGACTAGCATTATTATGGAACTTCCCATCAATGTTGTTTATCTCATTG
CTGGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGATTGTGA
TGTTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATGACCAGGTATTAC
CTTACTTCATCATGCAGAAGTTGGGACATTTGACCGGAATTCCCGGGTTG
TTCATGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCATCAAGCAT
AAATGGTTTATCAGCTCTTCTGTTGGAAGACTTCATAAGAAAGATTCGAC
CAAATATCACCGATACCAATGCCAAGAAAATGTCCATGTTACTCGcattt
tcttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCATCTCAAATCTTGG
GAACCTTGTCTCCCAGATCTCGTTCACAGTGATCGGGACATTGGGAAGTC
CATATTTGGGCATGTTCACCTTGGGAATGATGAATCCATGGTCCAATACC
AAGGGTGCATACACAGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCT
GGCAATCGGTGCTATTTTCAATCCACCGAATGCTTACCCAAAAGTAGTAC
ACGTGGATGGCTGTGCAGGGTTTAATTCAACGAACGTAACAAATACGATA
TTGCACGGAAGTGGGATCATCAGACCTACAGATCAATATGTCCCCTCTTC
GTCATCTTTGGCATCATTTTATTCCATATCATACCTGTGGTACGGTTTGA
TTGGTTTAACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTT
AAACGGATATCACCAAACAATGAAGTGTACGTTGATGAGAAACTGTTGTT
TATTTATAAAGAAACCGAAGATAAGAAGATCACGAAGAGAGATGAAGAAA
GAGAAGATCCAGTGGAAGAAAATCATTTTACGGATGACACGCAAAAATGG
ACAAACACCAAATTATCCATTCCTCGTTTCCAACGTTGTCGATTGACATT
CGAATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGA
TGTATCTATTTCCTCGACTCGTATCATCTAAATCGATTGCATCGCTTAAT
TTTCTCGTATAAATGCTAACAAAGTTAAACAAACTTAATTACCTTAATCG
TAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAATCAAAATGT
CCACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTACCTCGTCTTT
GCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTTCGCTCGTAA
AGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGAACGAACGACTAA
ACATCCTGAGTAAACAAGGAACGAAAGATACAAACGAAAATGGTGATAAT
CAGAAGGAGACTGATGAATATTTAGTCGGTGGACGAAACATGCATTGGTT
TCCACTTTCAATTTCCTTTATGGCAACATACATCTCTGCAAGCTCTTTAT
TGGGTATTCCAGCGGAGATTTACACATATggttttcaatatattgtctcT
TGTGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACATTTTCATACC
GATCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGTATTTAGAATTAC
GATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATCATGTCAATTTAC
ATGTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCTGGCATTTGA
AGCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTGACTggtctgg
tctgtattttctaCACAACGATAGGAGGTATCAAAGCAGTTGTATGGACA
GATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTCGTTATCAT
CATCGGGGTGGAAGAGGTCGGGAGTATTgggaagatttttgaaaaagcac
AGCAAGGTGAAAGAATACATATTCTAAACTTTGATCCAGACCCCCGTATT
CGAAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTACCATCTTACC
AGCATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGGCTGCCAAAT
CAATGAAAGAGGCTAGACTAGCATTATTATGGAACTTCCCATCAATGTTG
TTTATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAA
TGCAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATG
ACCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGACATTTGACCGGA
ATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGT
TTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAGACTTCATAA
GAAAGATTCGACCAAATATCACCGATACCAATGCCAAGAAAATGTCCATG
TTACTCGcattttcttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCAT
CTCAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAGTGATCGGGA
CATTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGAATGATGAATCCA
TGGTCCAATACCAAGGGTGCATACACAGGCTTTCTGTTCGGCCTAGGAAC
CACACTATGGCTGGCAATCGGTGCTATTTTCAATCCACCGAATGCTTACC
CAAAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTCAACGAACGTA
ACAAATACGATATTGCACGGAAGTGGGATCATCAGACCTACAGATCAATA
TGTCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCATATCATACCTGT
GGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTTCAGTTGCG
TCCGCAATCTTTAAACGGATATCACCAAACAATGAAGTGTACGTTGATGA
GAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAGATCACGAAGA
GAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTTACGGATGAC
ACGCAAAAATGGACAAACACCAAATTATCCATTCCTCGTTTCCAACGTTG
TCGATTGACATTCGAATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTT
TAGTGGTTGCGATGTATCTATTTCCTCGACTCGTATCATCTAAATCGATT
GCATCGCTTAATTTTCTCGTATAAATGCTAACAAAGTTAAACAAACTTAA
TTACCTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGC
CAATCAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAATTGTTGAC
TACCTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTA
TTTCGCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGA
ACGAACGACTAAACATCCTGAGTAAACAAGGAACGAAAGATACAAACGAA
AATGGTGATAATCAGAAGGAGACTGATGAATATTTAGTCGGTGGACGAAA
CATGCATTGGTTTCCACTTTCAATTTCCTTTATGGCAACATACATCTCTG
CAAGCTCTTTATTGGGTATTCCAGCGGAGATTTACACATATggttttcaa
tatattgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTA
CATTTTCATACCGATCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGT
ATTTAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATC
ATGTCAATTTACATGTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGC
CCTGGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAG
TGACTggtctggtctgtattttctaCACAACGATAGGAGGTATCAAAGCA
GTTGTATGGACAGATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACT
CGTCGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATTgggaagattt
ttgaaaaagcacAGCAAGGTGAAAGAATACATATTCTAAACTTTGATCCA
GACCCCCGTATTCGAAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTT
TACCATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCC
AGGCTGCCAAATCAATGAAAGAGGCTAGACTAGCATTATTATGGAACTTC
CCATCAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGAT
ATATGCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTG
TGGACAGGAATGACCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGA
CATTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGC
TTTGAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGG
AAGACTTCATAAGAAAGATTCGACCAAATATCACCGATACCAATGCCAAG
AAAATGTCCATGTTACTCGcattttcttcAGGGTTATGTGGCATCGGGTT
ATCCTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCA
CAGTGATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGA
ATGATGAATCCATGGTCCAATACCAAGGGTGCATACACAGGCTTTCTGTT
CGGCCTAGGAACCACACTATGGCTGGCAATCGGTGCTATTTTCAATCCAC
CGAATGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAAT
TCAACGAACGTAACAAATACGATATTGCACGGAAGTGGGATCATCAGACC
TACAGATCAATATGTCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCA
TATCATACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTT
GGTTCAGTTGCGTCCGCAATCTTTAAACGGATATCACCAAACAATGAAGT
GTACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAGA
AGATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCAT
TTTACGGATGACACGCAAAAATGGACAAACACCAAATTATCCATTCCTCG
TTTCCAACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTTATCGACTG
TCGTGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGACTCGTATCA
TCTAAATCGATTGCATCGCTTAATTTTCTCGTATAAATGCTAACAAAGTT
AAACAAACTTAATTACCTTAATCGTAATCTGAGCATACTTTCCTTATCAC
CAAAGCAGCAGCCAATCAAAATGTCCACAACGTCGTCACAGTTCACACTT
TCAATTGTTGACTACCTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGT
CATTGGGATCTATTTCGCTCGTAAAGGCAAACCCGCATCATCACCATCAT
CGAAAGAGAAGAACGAACGACTAAACATCCTGAGTAAACAAGGAACGAAA
GATACAAACGAAAATGGTGATAATCAGAAGGAGACTGATGAATATTTAGT
CGGTGGACGAAACATGCATTGGTTTCCACTTTCAATTTCCTTTATGGCAA
CATACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGATTTACACA
TATggttttcaatatattgtctcTTGTGGTGCACTGTTTGTCTCAACCTT
TTTCACTTGGTACATTTTCATACCGATCTTCTACAGACTGAAAATTGTGT
GTGCGAATGAGTATTTAGAATTACGATTTTCAAGAGGTGTTCGAAATATC
GGCTGCATCATCATGTCAATTTACATGTTGATTAGCTTGTCGATCGGTTT
ATATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACG
TATCTATTACAGTGACTggtctggtctgtattttctaCACAACGATAGGA
GGTATCAAAGCAGTTGTATGGACAGATTGTTTTCAAGCATTCGTAATGAT
CGCAGGTCTACTCGTCGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTA
TTgggaagatttttgaaaaagcacAGCAAGGTGAAAGAATACATATTCTA
AACTTTGATCCAGACCCCCGTATTCGAAACACTTTTTGGTCACTAATCTT
TGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCAACAATCTG
TTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGACTAGCATTA
TTATGGAACTTCCCATCAATGTTGTTTATCTCATTGCTGGCAATGTTAGC
AGGTTTGGTGATATATGCAGTGAATGCAGATTGTGATGTTGGAGTTTATG
GGTTGCATCTTGTGGACAGGAATGACCAGGTATTACCTTACTTCATCATG
CAGAAGTTGGGACATTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCT
CTTTAGCAGTGCTTTGAGCACGGTTTCATCAAGCATAAATGGTTTATCAG
CTCTTCTGTTGGAAGACTTCATAAGAAAGATTCGACCAAATATCACCGAT
ACCAATGCCAAGAAAATGTCCATGTTACTCGcattttcttcAGGGTTATG
TGGCATCGGGTTATCCTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCC
AGATCTCGTTCACAGTGATCGGGACATTGGGAAGTCCATATTTGGGCATG
TTCACCTTGGGAATGATGAATCCATGGTCCAATACCAAGGGTGCATACAC
AGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCAATCGGTGCTA
TTTTCAATCCACCGAATGCTTACCCAAAAGTAGTACACGTGGATGGCTGT
GCAGGGTTTAATTCAACGAACGTAACAAATACGATATTGCACGGAAGTGG
GATCATCAGACCTACAGATCAATATGTCCCCTCTTCGTCATCTTTGGCAT
CATTTTATTCCATATCATACCTGTGGTACGGTTTGATTGGTTTAACCGTT
ACCATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAACGGATATCACC
AAACAATGAAGTGTACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAA
CCGAAGATAAGAAGATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTG
GAAGAAAATCATTTTACGGATGACACGCAAAAATGGACAAACACCAAATT
ATCCATTCCTCGTTTCCAACGTTGTCGATTGACATTCGAATCCTTCGAGG
TTTTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCT
CGACTCGTATCATCTAAATCGATTGCATCGCTTAATTTTCTCGTATAAAT
GCTAACAAAGTTAAACAAACTTAATTACCTTAATCGTAATCTGAGCATAC
TTTCCTTATCACCAAAGCAGCAGCCAATCAAAATGTCCACAACGTCGTCA
CAGTTCACACTTTCAATTGTTGACTACCTCGTCTTTGCGATCGTCTTGGT
GGCGTCTAGTGTCATTGGGATCTATTTCGCTCGTAAAGGCAAACCCGCAT
CATCACCATCATCGAAAGAGAAGAACGAACGACTAAACATCCTGAGTAAA
CAAGGAACGAAAGATACAAACGAAAATGGTGATAATCAGAAGGAGACTGA
TGAATATTTAGTCGGTGGACGAAACATGCATTGGTTTCCACTTTCAATTT
CCTTTATGGCAACATACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCG
GAGATTTACACATATggttttcaatatattgtctcTTGTGGTGCACTGTT
TGTCTCAACCTTTTTCACTTGGTACATTTTCATACCGATCTTCTACAGAC
TGAAAATTGTGTGTGCGAATGAGTATTTAGAATTACGATTTTCAAGAGGT
GTTCGAAATATCGGCTGCATCATCATGTCAATTTACATGTTGATTAGCTT
GTCGATCGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTG
TTCCACTTTACGTATCTATTACAGTGACTggtctggtctgtattttctaC
ACAACGATAGGAGGTATCAAAGCAGTTGTATGGACAGATTGTTTTCAAGC
ATTCGTAATGATCGCAGGTCTACTCGTCGTTATCATCATCGGGGTGGAAG
AGGTCGGGAGTATTgggaagatttttgaaaaagcacAGCAAGGTGAAAGA
ATACATATTCTAAACTTTGATCCAGACCCCCGTATTCGAAACACTTTTTG
GTCACTAATCTTTGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCG
GTCAACAATCTGTTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCT
AGACTAGCATTATTATGGAACTTCCCATCAATGTTGTTTATCTCATTGCT
GGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGATTGTGATG
TTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATGACCAGGTATTACCT
TACTTCATCATGCAGAAGTTGGGACATTTGACCGGAATTCCCGGGTTGTT
CATGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCATCAAGCATAA
ATGGTTTATCAGCTCTTCTGTTGGAAGACTTCATAAGAAAGATTCGACCA
AATATCACCGATACCAATGCCAAGAAAATGTCCATGTTACTCGcattttc
ttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCATCTCAAATCTTGGGA
ACCTTGTCTCCCAGATCTCGTTCACAGTGATCGGGACATTGGGAAGTCCA
TATTTGGGCATGTTCACCTTGGGAATGATGAATCCATGGTCCAATACCAA
GGGTGCATACACAGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGG
CAATCGGTGCTATTTTCAATCCACCGAATGCTTACCCAAAAGTAGTACAC
GTGGATGGCTGTGCAGGGTTTAATTCAACGAACGTAACAAATACGATATT
GCACGGAAGTGGGATCATCAGACCTACAGATCAATATGTCCCCTCTTCGT
CATCTTTGGCATCATTTTATTCCATATCATACCTGTGGTACGGTTTGATT
GGTTTAACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAA
ACGGATATCACCAAACAATGAAGTGTACGTTGATGAGAAACTGTTGTTTA
TTTATAAAGAAACCGAAGATAAGAAGATCACGAAGAGAGATGAAGAAAGA
GAAGATCCAGTGGAAGAAAATCATTTTACGGATGACACGCAAAAATGGAC
AAACACCAAATTATCCATTCCTCGTTTCCAACGTTGTCGATTGACATTCG
AATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATG
TATCTATTTCCTCGACTCGTATCATCTAAATCGATTGCATCGCTTAATTT
TCTCGTATAAATGCTAACAAAGTTAAACAAACTTAATTACCTTAATCGTA
ATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAATCAAAATGTCC
ACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTACCTCGTCTTTGC
GATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTTCGCTCGTAAAG
GCAAACCCGCATCATCACCATCATCGAAAGAGAAGAACGAACGACTAAAC
ATCCTGAGTAAACAAGGAACGAAAGATACAAACGAAAATGGTGATAATCA
GAAGGAGACTGATGAATATTTAGTCGGTGGACGAAACATGCATTGGTTTC
CACTTTCAATTTCCTTTATGGCAACATACATCTCTGCAAGCTCTTTATTG
GGTATTCCAGCGGAGATTTACACATATggttttcaatatattgtctcTTG
TGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACATTTTCATACCGA
TCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGTATTTAGAATTACGA
TTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATCATGTCAATTTACAT
GTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCTGGCATTTGAAG
CAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTGACTggtctggtc
tgtattttctaCACAACGATAGGAGGTATCAAAGCAGTTGTATGGACAGA
TTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTCGTTATCATCA
TCGGGGTGGAAGAGGTCGGGAGTATTgggaagatttttgaaaaagcacAG
CAAGGTGAAAGAATACATATTCTAAACTTTGATCCAGACCCCCGTATTCG
AAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTACCATCTTACCAG
CATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGGCTGCCAAATCA
ATGAAAGAGGCTAGACTAGCATTATTATGGAACTTCCCATCAATGTTGTT
TATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAATG
CAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATGAC
CAGGTATTACCTTACTTCATCATGCAGAAGTTGGGACATTTGACCGGAAT
TCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTT
CATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAGACTTCATAAGA
AAGATTCGACCAAATATCACCGATACCAATGCCAAGAAAATGTCCATGTT
ACTCGcattttcttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCATCT
CAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAGTGATCGGGACA
TTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGAATGATGAATCCATG
GTCCAATACCAAGGGTGCATACACAGGCTTTCTGTTCGGCCTAGGAACCA
CACTATGGCTGGCAATCGGTGCTATTTTCAATCCACCGAATGCTTACCCA
AAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTCAACGAACGTAAC
AAATACGATATTGCACGGAAGTGGGATCATCAGACCTACAGATCAATATG
TCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCATATCATACCTGTGG
TACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTTCAGTTGCGTC
CGCAATCTTTAAACGGATATCACCAAACAATGAAGTGTACGTTGATGAGA
AACTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAGATCACGAAGAGA
GATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTTACGGATGACAC
GCAAAAATGGACAAACACCAAATTATCCATTCCTCGTTTCCAACGTTGTC
GATTGACATTCGAATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTA
GTGGTTGCGATGTATCTATTTCCTCGACTCGTATCATCTAAATCGATTGC
ATCGCTTAATTTTCTCGTATAAATGCTAACAAAGTTAAACAAACTTAATT
ACCTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCA
ATCAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTA
CCTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATT
TCGCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGAAC
GAACGACTAAACATCCTGAGTAAACAAGGAACGAAAGATACAAACGAAAA
TGGTGATAATCAGAAGGAGACTGATGAATATTTAGTCGGTGGACGAAACA
TGCATTGGTTTCCACTTTCAATTTCCTTTATGGCAACATACATCTCTGCA
AGCTCTTTATTGGGTATTCCAGCGGAGATTTACACATATggttttcaata
tattgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACA
TTTTCATACCGATCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGTAT
TTAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATCAT
GTCAATTTACATGTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCC
TGGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTG
ACTggtctggtctgtattttctaCACAACGATAGGAGGTATCAAAGCAGT
TGTATGGACAGATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCG
TCGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATTgggaagattttt
gaaaaagcacAGCAAGGTGAAAGAATACATATTCTAAACTTTGATCCAGA
CCCCCGTATTCGAAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTA
CCATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAG
GCTGCCAAATCAATGAAAGAGGCTAGACTAGCATTATTATGGAACTTCCC
ATCAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATAT
ATGCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTG
GACAGGAATGACCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGACA
TTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTT
TGAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAA
GACTTCATAAGAAAGATTCGACCAAATATCACCGATACCAATGCCAAGAA
AATGTCCATGTTACTCGcattttcttcAGGGTTATGTGGCATCGGGTTAT
CCTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACA
GTGATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGAAT
GATGAATCCATGGTCCAATACCAAGGGTGCATACACAGGCTTTCTGTTCG
GCCTAGGAACCACACTATGGCTGGCAATCGGTGCTATTTTCAATCCACCG
AATGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTC
AACGAACGTAACAAATACGATATTGCACGGAAGTGGGATCATCAGACCTA
CAGATCAATATGTCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCATA
TCATACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGG
TTCAGTTGCGTCCGCAATCTTTAAACGGATATCACCAAACAATGAAGTGT
ACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAG
ATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTT
TACGGATGACACGCAAAAATGGACAAACACCAAATTATCCATTCCTCGTT
TCCAACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTTATCGACTGTC
GTGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGACTCGTATCATC
TAAATCGATTGCATCGCTTAATTTTCTCGTATAAATGCTAACAAAGTTAA
ACAAACTTAATTACCTTAATCGTAATCTGAGCATACTTTCCTTATCACCA
AAGCAGCAGCCAATCAAAATGTCCACAACGTCGTCACAGTTCACACTTTC
AATTGTTGACTACCTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCA
TTGGGATCTATTTCGCTCGTAAAGGCAAACCCGCATCATCACCATCATCG
AAAGAGAAGAACGAACGACTAAACATCCTGAGTAAACAAGGAACGAAAGA
TACAAACGAAAATGGTGATAATCAGAAGGAGACTGATGAATATTTAGTCG
GTGGACGAAACATGCATTGGTTTCCACTTTCAATTTCCTTTATGGCAACA
TACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGATTTACACATA
TggttttcaatatattgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTT
TCACTTGGTACATTTTCATACCGATCTTCTACAGACTGAAAATTGTGTGT
GCGAATGAGTATTTAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGG
CTGCATCATCATGTCAATTTACATGTTGATTAGCTTGTCGATCGGTTTAT
ATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTA
TCTATTACAGTGACTggtctggtctgtattttctaCACAACGATAGGAGG
TATCAAAGCAGTTGTATGGACAGATTGTTTTCAAGCATTCGTAATGATCG
CAGGTCTACTCGTCGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATT
gggaagatttttgaaaaagcacAGCAAGGTGAAAGAATACATATTCTAAA
CTTTGATCCAGACCCCCGTATTCGAAACACTTTTTGGTCACTAATCTTTG
GTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTT
CAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGACTAGCATTATT
ATGGAACTTCCCATCAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAG
GTTTGGTGATATATGCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGG
TTGCATCTTGTGGACAGGAATGACCAGGTATTACCTTACTTCATCATGCA
GAAGTTGGGACATTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCT
TTAGCAGTGCTTTGAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCT
CTTCTGTTGGAAGACTTCATAAGAAAGATTCGACCAAATATCACCGATAC
CAATGCCAAGAAAATGTCCATGTTACTCGcattttcttcAGGGTTATGTG
GCATCGGGTTATCCTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAG
ATCTCGTTCACAGTGATCGGGACATTGGGAAGTCCATATTTGGGCATGTT
CACCTTGGGAATGATGAATCCATGGTCCAATACCAAGGGTGCATACACAG
GCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCAATCGGTGCTATT
TTCAATCCACCGAATGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGC
AGGGTTTAATTCAACGAACGTAACAAATACGATATTGCACGGAAGTGGGA
TCATCAGACCTACAGATCAATATGTCCCCTCTTCGTCATCTTTGGCATCA
TTTTATTCCATATCATACCTGTGGTACGGTTTGATTGGTTTAACCGTTAC
CATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAACGGATATCACCAA
ACAATGAAGTGTACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACC
GAAGATAAGAAGATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGA
AGAAAATCATTTTACGGATGACACGCAAAAATGGACAAACACCAAATTAT
CCATTCCTCGTTTCCAACGTTGTCGATTGACATTCGAATCCTTCGAGGTT
TTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCG
ACTCGTATCATCTAAATCGATTGCATCGCTTAATTTTCTCGTATAAATGC
TAACAAAGTTAAACAAACTTAATTACCTTAATCGTAATCTGAGCATACTT
TCCTTATCACCAAAGCAGCAGCCAATCAAAATGTCCACAACGTCGTCACA
GTTCACACTTTCAATTGTTGACTACCTCGTCTTTGCGATCGTCTTGGTGG
CGTCTAGTGTCATTGGGATCTATTTCGCTCGTAAAGGCAAACCCGCATCA
TCACCATCATCGAAAGAGAAGAACGAACGACTAAACATCCTGAGTAAACA
AGGAACGAAAGATACAAACGAAAATGGTGATAATCAGAAGGAGACTGATG
AATATTTAGTCGGTGGACGAAACATGCATTGGTTTCCACTTTCAATTTCC
TTTATGGCAACATACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGA
GATTTACACATATggttttcaatatattgtctcTTGTGGTGCACTGTTTG
TCTCAACCTTTTTCACTTGGTACATTTTCATACCGATCTTCTACAGACTG
AAAATTGTGTGTGCGAATGAGTATTTAGAATTACGATTTTCAAGAGGTGT
TCGAAATATCGGCTGCATCATCATGTCAATTTACATGTTGATTAGCTTGT
CGATCGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTT
CCACTTTACGTATCTATTACAGTGACTggtctggtctgtattttctaCAC
AACGATAGGAGGTATCAAAGCAGTTGTATGGACAGATTGTTTTCAAGCAT
TCGTAATGATCGCAGGTCTACTCGTCGTTATCATCATCGGGGTGGAAGAG
GTCGGGAGTATTgggaagatttttgaaaaagcacAGCAAGGTGAAAGAAT
ACATATTCTAAACTTTGATCCAGACCCCCGTATTCGAAACACTTTTTGGT
CACTAATCTTTGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGT
CAACAATCTGTTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAG
ACTAGCATTATTATGGAACTTCCCATCAATGTTGTTTATCTCATTGCTGG
CAATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGATTGTGATGTT
GGAGTTTATGGGTTGCATCTTGTGGACAGGAATGACCAGGTATTACCTTA
CTTCATCATGCAGAAGTTGGGACATTTGACCGGAATTCCCGGGTTGTTCA
TGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCATCAAGCATAAAT
GGTTTATCAGCTCTTCTGTTGGAAGACTTCATAAGAAAGATTCGACCAAA
TATCACCGATACCAATGCCAAGAAAATGTCCATGTTACTCGcattttctt
cAGGGTTATGTGGCATCGGGTTATCCTTTCTCATCTCAAATCTTGGGAAC
CTTGTCTCCCAGATCTCGTTCACAGTGATCGGGACATTGGGAAGTCCATA
TTTGGGCATGTTCACCTTGGGAATGATGAATCCATGGTCCAATACCAAGG
GTGCATACACAGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCA
ATCGGTGCTATTTTCAATCCACCGAATGCTTACCCAAAAGTAGTACACGT
GGATGGCTGTGCAGGGTTTAATTCAACGAACGTAACAAATACGATATTGC
ACGGAAGTGGGATCATCAGACCTACAGATCAATATGTCCCCTCTTCGTCA
TCTTTGGCATCATTTTATTCCATATCATACCTGTGGTACGGTTTGATTGG
TTTAACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAAC
GGATATCACCAAACAATGAAGTGTACGTTGATGAGAAACTGTTGTTTATT
TATAAAGAAACCGAAGATAAGAAGATCACGAAGAGAGATGAAGAAAGAGA
AGATCCAGTGGAAGAAAATCATTTTACGGATGACACGCAAAAATGGACAA
ACACCAAATTATCCATTCCTCGTTTCCAACGTTGTCGATTGACATTCGAA
TCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTA
TCTATTTCCTCGACTCGTATCATCTAAATCGATTGCATCGCTTAATTTTC
TCGTATAAATGCTAACAAAGTTAAACAAACTTAATTACCTTAATCGTAAT
CTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAATCAAAATGTCCAC
AACGTCGTCACAGTTCACACTTTCAATTGTTGACTACCTCGTCTTTGCGA
TCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTTCGCTCGTAAAGGC
AAACCCGCATCATCACCATCATCGAAAGAGAAGAACGAACGACTAAACAT
CCTGAGTAAACAAGGAACGAAAGATACAAACGAAAATGGTGATAATCAGA
AGGAGACTGATGAATATTTAGTCGGTGGACGAAACATGCATTGGTTTCCA
CTTTCAATTTCCTTTATGGCAACATACATCTCTGCAAGCTCTTTATTGGG
TATTCCAGCGGAGATTTACACATATggttttcaatatattgtctcTTGTG
GTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACATTTTCATACCGATC
TTCTACAGACTGAAAATTGTGTGTGCGAATGAGTATTTAGAATTACGATT
TTCAAGAGGTGTTCGAAATATCGGCTGCATCATCATGTCAATTTACATGT
TGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCTGGCATTTGAAGCA
GTTGGCGGTGTTCCACTTTACGTATCTATTACAGTGACTggtctggtctg
tattttctaCACAACGATAGGAGGTATCAAAGCAGTTGTATGGACAGATT
GTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTCGTTATCATCATC
GGGGTGGAAGAGGTCGGGAGTATTgggaagatttttgaaaaagcacAGCA
AGGTGAAAGAATACATATTCTAAACTTTGATCCAGACCCCCGTATTCGAA
ACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTACCATCTTACCAGCA
TGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGGCTGCCAAATCAAT
GAAAGAGGCTAGACTAGCATTATTATGGAACTTCCCATCAATGTTGTTTA
TCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCA
GATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATGACCA
GGTATTACCTTACTTCATCATGCAGAAGTTGGGACATTTGACCGGAATTC
CCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCA
TCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAGACTTCATAAGAAA
GATTCGACCAAATATCACCGATACCAATGCCAAGAAAATGTCCATGTTAC
TCGcattttcttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCATCTCA
AATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAGTGATCGGGACATT
GGGAAGTCCATATTTGGGCATGTTCACCTTGGGAATGATGAATCCATGGT
CCAATACCAAGGGTGCATACACAGGCTTTCTGTTCGGCCTAGGAACCACA
CTATGGCTGGCAATCGGTGCTATTTTCAATCCACCGAATGCTTACCCAAA
AGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTCAACGAACGTAACAA
ATACGATATTGCACGGAAGTGGGATCATCAGACCTACAGATCAATATGTC
CCCTCTTCGTCATCTTTGGCATCATTTTATTCCATATCATACCTGTGGTA
CGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCG
CAATCTTTAAACGGATATCACCAAACAATGAAGTGTACGTTGATGAGAAA
CTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAGATCACGAAGAGAGA
TGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTTACGGATGACACGC
AAAAATGGACAAACACCAAATTATCCATTCCTCGTTTCCAACGTTGTCGA
TTGACATTCGAATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGT
GGTTGCGATGTATCTATTTCCTCGACTCGTATCATCTAAATCGATTGCAT
CGCTTAATTTTCTCGTATAAATGCTAACAAAGTTAAACAAACTTAATTAC
CTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAAT
CAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTACC
TCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTTC
GCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGAACGA
ACGACTAAACATCCTGAGTAAACAAGGAACGAAAGATACAAACGAAAATG
GTGATAATCAGAAGGAGACTGATGAATATTTAGTCGGTGGACGAAACATG
CATTGGTTTCCACTTTCAATTTCCTTTATGGCAACATACATCTCTGCAAG
CTCTTTATTGGGTATTCCAGCGGAGATTTACACATATggttttcaatata
ttgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACATT
TTCATACCGATCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGTATTT
AGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATCATGT
CAATTTACATGTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCTG
GCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTGAC
TggtctggtctgtattttctaCACAACGATAGGAGGTATCAAAGCAGTTG
TATGGACAGATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTC
GTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATTgggaagatttttga
aaaagcacAGCAAGGTGAAAGAATACATATTCTAAACTTTGATCCAGACC
CCCGTATTCGAAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTACC
ATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGGC
TGCCAAATCAATGAAAGAGGCTAGACTAGCATTATTATGGAACTTCCCAT
CAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATATAT
GCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGA
CAGGAATGACCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGACATT
TGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTTG
AGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAGA
CTTCATAAGAAAGATTCGACCAAATATCACCGATACCAATGCCAAGAAAA
TGTCCATGTTACTCGcattttcttcAGGGTTATGTGGCATCGGGTTATCC
TTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAGT
GATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGAATGA
TGAATCCATGGTCCAATACCAAGGGTGCATACACAGGCTTTCTGTTCGGC
CTAGGAACCACACTATGGCTGGCAATCGGTGCTATTTTCAATCCACCGAA
TGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTCAA
CGAACGTAACAAATACGATATTGCACGGAAGTGGGATCATCAGACCTACA
GATCAATATGTCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCATATC
ATACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTT
CAGTTGCGTCCGCAATCTTTAAACGGATATCACCAAACAATGAAGTGTAC
GTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAGAT
CACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTTA
CGGATGACACGCAAAAATGGACAAACACCAAATTATCCATTCCTCGTTTC
CAACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTTATCGACTGTCGT
GGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGACTCGTATCATCTA
AATCGATTGCATCGCTTAATTTTCTCGTATAAATGCTAACAAAGTTAAAC
AAACTTAATTACCTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAA
GCAGCAGCCAATCAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAA
TTGTTGACTACCTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATT
GGGATCTATTTCGCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAA
AGAGAAGAACGAACGACTAAACATCCTGAGTAAACAAGGAACGAAAGATA
CAAACGAAAATGGTGATAATCAGAAGGAGACTGATGAATATTTAGTCGGT
GGACGAAACATGCATTGGTTTCCACTTTCAATTTCCTTTATGGCAACATA
CATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGATTTACACATATg
gttttcaatatattgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTC
ACTTGGTACATTTTCATACCGATCTTCTACAGACTGAAAATTGTGTGTGC
GAATGAGTATTTAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCT
GCATCATCATGTCAATTTACATGTTGATTAGCTTGTCGATCGGTTTATAT
GGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATC
TATTACAGTGACTggtctggtctgtattttctaCACAACGATAGGAGGTA
TCAAAGCAGTTGTATGGACAGATTGTTTTCAAGCATTCGTAATGATCGCA
GGTCTACTCGTCGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATTgg
gaagatttttgaaaaagcacAGCAAGGTGAAAGAATACATATTCTAAACT
TTGATCCAGACCCCCGTATTCGAAACACTTTTTGGTCACTAATCTTTGGT
GTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCA
ACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGACTAGCATTATTAT
GGAACTTCCCATCAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGT
TTGGTGATATATGCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTT
GCATCTTGTGGACAGGAATGACCAGGTATTACCTTACTTCATCATGCAGA
AGTTGGGACATTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTT
AGCAGTGCTTTGAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCT
TCTGTTGGAAGACTTCATAAGAAAGATTCGACCAAATATCACCGATACCA
ATGCCAAGAAAATGTCCATGTTACTCGcattttcttcAGGGTTATGTGGC
ATCGGGTTATCCTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGAT
CTCGTTCACAGTGATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCA
CCTTGGGAATGATGAATCCATGGTCCAATACCAAGGGTGCATACACAGGC
TTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCAATCGGTGCTATTTT
CAATCCACCGAATGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAG
GGTTTAATTCAACGAACGTAACAAATACGATATTGCACGGAAGTGGGATC
ATCAGACCTACAGATCAATATGTCCCCTCTTCGTCATCTTTGGCATCATT
TTATTCCATATCATACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCA
TTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAACGGATATCACCAAAC
AATGAAGTGTACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGA
AGATAAGAAGATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAG
AAAATCATTTTACGGATGACACGCAAAAATGGACAAACACCAAATTATCC
ATTCCTCGTTTCCAACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTT
ATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGAC
TCGTATCATCTAAATCGATTGCATCGCTTAATTTTCTCGTATAAATGCTA
ACAAAGTTAAACAAACTTAATTACCTTAATCGTAATCTGAGCATACTTTC
CTTATCACCAAAGCAGCAGCCAATCAAAATGTCCACAACGTCGTCACAGT
TCACACTTTCAATTGTTGACTACCTCGTCTTTGCGATCGTCTTGGTGGCG
TCTAGTGTCATTGGGATCTATTTCGCTCGTAAAGGCAAACCCGCATCATC
ACCATCATCGAAAGAGAAGAACGAACGACTAAACATCCTGAGTAAACAAG
GAACGAAAGATACAAACGAAAATGGTGATAATCAGAAGGAGACTGATGAA
TATTTAGTCGGTGGACGAAACATGCATTGGTTTCCACTTTCAATTTCCTT
TATGGCAACATACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGA
TTTACACATATggttttcaatatattgtctcTTGTGGTGCACTGTTTGTC
TCAACCTTTTTCACTTGGTACATTTTCATACCGATCTTCTACAGACTGAA
AATTGTGTGTGCGAATGAGTATTTAGAATTACGATTTTCAAGAGGTGTTC
GAAATATCGGCTGCATCATCATGTCAATTTACATGTTGATTAGCTTGTCG
ATCGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTTCC
ACTTTACGTATCTATTACAGTGACTggtctggtctgtattttctaCACAA
CGATAGGAGGTATCAAAGCAGTTGTATGGACAGATTGTTTTCAAGCATTC
GTAATGATCGCAGGTCTACTCGTCGTTATCATCATCGGGGTGGAAGAGGT
CGGGAGTATTgggaagatttttgaaaaagcacAGCAAGGTGAAAGAATAC
ATATTCTAAACTTTGATCCAGACCCCCGTATTCGAAACACTTTTTGGTCA
CTAATCTTTGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCA
ACAATCTGTTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGAC
TAGCATTATTATGGAACTTCCCATCAATGTTGTTTATCTCATTGCTGGCA
ATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGATTGTGATGTTGG
AGTTTATGGGTTGCATCTTGTGGACAGGAATGACCAGGTATTACCTTACT
TCATCATGCAGAAGTTGGGACATTTGACCGGAATTCCCGGGTTGTTCATG
GCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCATCAAGCATAAATGG
TTTATCAGCTCTTCTGTTGGAAGACTTCATAAGAAAGATTCGACCAAATA
TCACCGATACCAATGCCAAGAAAATGTCCATGTTACTCGcattttcttcA
GGGTTATGTGGCATCGGGTTATCCTTTCTCATCTCAAATCTTGGGAACCT
TGTCTCCCAGATCTCGTTCACAGTGATCGGGACATTGGGAAGTCCATATT
TGGGCATGTTCACCTTGGGAATGATGAATCCATGGTCCAATACCAAGGGT
GCATACACAGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCAAT
CGGTGCTATTTTCAATCCACCGAATGCTTACCCAAAAGTAGTACACGTGG
ATGGCTGTGCAGGGTTTAATTCAACGAACGTAACAAATACGATATTGCAC
GGAAGTGGGATCATCAGACCTACAGATCAATATGTCCCCTCTTCGTCATC
TTTGGCATCATTTTATTCCATATCATACCTGTGGTACGGTTTGATTGGTT
TAACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAACGG
ATATCACCAAACAATGAAGTGTACGTTGATGAGAAACTGTTGTTTATTTA
TAAAGAAACCGAAGATAAGAAGATCACGAAGAGAGATGAAGAAAGAGAAG
ATCCAGTGGAAGAAAATCATTTTACGGATGACACGCAAAAATGGACAAAC
ACCAAATTATCCATTCCTCGTTTCCAACGTTGTCGATTGACATTCGAATC
CTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTATC
TATTTCCTCGACTCGTATCATCTAAATCGATTGCATCGCTTAATTTTCTC
GTATAAATGCTAACAAAGTTAAACAAACTTAATTACCTTAATCGTAATCT
GAGCATACTTTCCTTATCACCAAAGCAGCAGCCAATCAAAATGTCCACAA
CGTCGTCACAGTTCACACTTTCAATTGTTGACTACCTCGTCTTTGCGATC
GTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTTCGCTCGTAAAGGCAA
ACCCGCATCATCACCATCATCGAAAGAGAAGAACGAACGACTAAACATCC
TGAGTAAACAAGGAACGAAAGATACAAACGAAAATGGTGATAATCAGAAG
GAGACTGATGAATATTTAGTCGGTGGACGAAACATGCATTGGTTTCCACT
TTCAATTTCCTTTATGGCAACATACATCTCTGCAAGCTCTTTATTGGGTA
TTCCAGCGGAGATTTACACATATggttttcaatatattgtctcTTGTGGT
GCACTGTTTGTCTCAACCTTTTTCACTTGGTACATTTTCATACCGATCTT
CTACAGACTGAAAATTGTGTGTGCGAATGAGTATTTAGAATTACGATTTT
CAAGAGGTGTTCGAAATATCGGCTGCATCATCATGTCAATTTACATGTTG
ATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGT
TGGCGGTGTTCCACTTTACGTATCTATTACAGTGACTggtctggtctgta
ttttctaCACAACGATAGGAGGTATCAAAGCAGTTGTATGGACAGATTGT
TTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTCGTTATCATCATCGG
GGTGGAAGAGGTCGGGAGTATTgggaagatttttgaaaaagcacAGCAAG
GTGAAAGAATACATATTCTAAACTTTGATCCAGACCCCCGTATTCGAAAC
ACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTACCATCTTACCAGCATG
GGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGGCTGCCAAATCAATGA
AAGAGGCTAGACTAGCATTATTATGGAACTTCCCATCAATGTTGTTTATC
TCATTGCTGGCAATGTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGA
TTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGACAGGAATGACCAGG
TATTACCTTACTTCATCATGCAGAAGTTGGGACATTTGACCGGAATTCCC
GGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCATC
AAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAGACTTCATAAGAAAGA
TTCGACCAAATATCACCGATACCAATGCCAAGAAAATGTCCATGTTACTC
GcattttcttcAGGGTTATGTGGCATCGGGTTATCCTTTCTCATCTCAAA
TCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAGTGATCGGGACATTGG
GAAGTCCATATTTGGGCATGTTCACCTTGGGAATGATGAATCCATGGTCC
AATACCAAGGGTGCATACACAGGCTTTCTGTTCGGCCTAGGAACCACACT
ATGGCTGGCAATCGGTGCTATTTTCAATCCACCGAATGCTTACCCAAAAG
TAGTACACGTGGATGGCTGTGCAGGGTTTAATTCAACGAACGTAACAAAT
ACGATATTGCACGGAAGTGGGATCATCAGACCTACAGATCAATATGTCCC
CTCTTCGTCATCTTTGGCATCATTTTATTCCATATCATACCTGTGGTACG
GTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCGCA
ATCTTTAAACGGATATCACCAAACAATGAAGTGTACGTTGATGAGAAACT
GTTGTTTATTTATAAAGAAACCGAAGATAAGAAGATCACGAAGAGAGATG
AAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTTACGGATGACACGCAA
AAATGGACAAACACCAAATTATCCATTCCTCGTTTCCAACGTTGTCGATT
GACATTCGAATCCTTCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTGG
TTGCGATGTATCTATTTCCTCGACTCGTATCATCTAAATCGATTGCATCG
CTTAATTTTCTCGTATAAATGCTAACAAAGTTAAACAAACTTAATTACCT
TAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGCAGCAGCCAATCA
AAATGTCCACAACGTCGTCACAGTTCACACTTTCAATTGTTGACTACCTC
GTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGGGATCTATTTCGC
TCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAGAGAAGAACGAAC
GACTAAACATCCTGAGTAAACAAGGAACGAAAGATACAAACGAAAATGGT
GATAATCAGAAGGAGACTGATGAATATTTAGTCGGTGGACGAAACATGCA
TTGGTTTCCACTTTCAATTTCCTTTATGGCAACATACATCTCTGCAAGCT
CTTTATTGGGTATTCCAGCGGAGATTTACACATATggttttcaatatatt
gtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTCACTTGGTACATTTT
CATACCGATCTTCTACAGACTGAAAATTGTGTGTGCGAATGAGTATTTAG
AATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGCATCATCATGTCA
ATTTACATGTTGATTAGCTTGTCGATCGGTTTATATGGGCCAGCCCTGGC
ATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATCTATTACAGTGACTg
gtctggtctgtattttctaCACAACGATAGGAGGTATCAAAGCAGTTGTA
TGGACAGATTGTTTTCAAGCATTCGTAATGATCGCAGGTCTACTCGTCGT
TATCATCATCGGGGTGGAAGAGGTCGGGAGTATTgggaagatttttgaaa
aagcacAGCAAGGTGAAAGAATACATATTCTAAACTTTGATCCAGACCCC
CGTATTCGAAACACTTTTTGGTCACTAATCTTTGGTGTTGGGTTTACCAT
CTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCAACGCTTCCAGGCTG
CCAAATCAATGAAAGAGGCTAGACTAGCATTATTATGGAACTTCCCATCA
ATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGTTTGGTGATATATGC
AGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTTGCATCTTGTGGACA
GGAATGACCAGGTATTACCTTACTTCATCATGCAGAAGTTGGGACATTTG
ACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAGCAGTGCTTTGAG
CACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTCTGTTGGAAGACT
TCATAAGAAAGATTCGACCAAATATCACCGATACCAATGCCAAGAAAATG
TCCATGTTACTCGcattttcttcAGGGTTATGTGGCATCGGGTTATCCTT
TCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGATCTCGTTCACAGTGA
TCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACCTTGGGAATGATG
AATCCATGGTCCAATACCAAGGGTGCATACACAGGCTTTCTGTTCGGCCT
AGGAACCACACTATGGCTGGCAATCGGTGCTATTTTCAATCCACCGAATG
CTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAGGGTTTAATTCAACG
AACGTAACAAATACGATATTGCACGGAAGTGGGATCATCAGACCTACAGA
TCAATATGTCCCCTCTTCGTCATCTTTGGCATCATTTTATTCCATATCAT
ACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATTTTGTTTGGTTCA
GTTGCGTCCGCAATCTTTAAACGGATATCACCAAACAATGAAGTGTACGT
TGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAGATAAGAAGATCA
CGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAAAATCATTTTACG
GATGACACGCAAAAATGGACAAACACCAAATTATCCATTCCTCGTTTCCA
ACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTTATCGACTGTCGTGG
AGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGACTCGTATCATCTAAA
TCGATTGCATCGCTTAATTTTCTCGTATAAATGCTAACAAAGTTAAACAA
ACTTAATTACCTTAATCGTAATCTGAGCATACTTTCCTTATCACCAAAGC
AGCAGCCAATCAAAATGTCCACAACGTCGTCACAGTTCACACTTTCAATT
GTTGACTACCTCGTCTTTGCGATCGTCTTGGTGGCGTCTAGTGTCATTGG
GATCTATTTCGCTCGTAAAGGCAAACCCGCATCATCACCATCATCGAAAG
AGAAGAACGAACGACTAAACATCCTGAGTAAACAAGGAACGAAAGATACA
AACGAAAATGGTGATAATCAGAAGGAGACTGATGAATATTTAGTCGGTGG
ACGAAACATGCATTGGTTTCCACTTTCAATTTCCTTTATGGCAACATACA
TCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGATTTACACATATggt
tttcaatatattgtctcTTGTGGTGCACTGTTTGTCTCAACCTTTTTCAC
TTGGTACATTTTCATACCGATCTTCTACAGACTGAAAATTGTGTGTGCGA
ATGAGTATTTAGAATTACGATTTTCAAGAGGTGTTCGAAATATCGGCTGC
ATCATCATGTCAATTTACATGTTGATTAGCTTGTCGATCGGTTTATATGG
GCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTTCCACTTTACGTATCTA
TTACAGTGACTggtctggtctgtattttctaCACAACGATAGGAGGTATC
AAAGCAGTTGTATGGACAGATTGTTTTCAAGCATTCGTAATGATCGCAGG
TCTACTCGTCGTTATCATCATCGGGGTGGAAGAGGTCGGGAGTATTggga
agatttttgaaaaagcacAGCAAGGTGAAAGAATACATATTCTAAACTTT
GATCCAGACCCCCGTATTCGAAACACTTTTTGGTCACTAATCTTTGGTGT
TGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCAACAATCTGTTCAAC
GCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGACTAGCATTATTATGG
AACTTCCCATCAATGTTGTTTATCTCATTGCTGGCAATGTTAGCAGGTTT
GGTGATATATGCAGTGAATGCAGATTGTGATGTTGGAGTTTATGGGTTGC
ATCTTGTGGACAGGAATGACCAGGTATTACCTTACTTCATCATGCAGAAG
TTGGGACATTTGACCGGAATTCCCGGGTTGTTCATGGCAGTGCTCTTTAG
CAGTGCTTTGAGCACGGTTTCATCAAGCATAAATGGTTTATCAGCTCTTC
TGTTGGAAGACTTCATAAGAAAGATTCGACCAAATATCACCGATACCAAT
GCCAAGAAAATGTCCATGTTACTCGcattttcttcAGGGTTATGTGGCAT
CGGGTTATCCTTTCTCATCTCAAATCTTGGGAACCTTGTCTCCCAGATCT
CGTTCACAGTGATCGGGACATTGGGAAGTCCATATTTGGGCATGTTCACC
TTGGGAATGATGAATCCATGGTCCAATACCAAGGGTGCATACACAGGCTT
TCTGTTCGGCCTAGGAACCACACTATGGCTGGCAATCGGTGCTATTTTCA
ATCCACCGAATGCTTACCCAAAAGTAGTACACGTGGATGGCTGTGCAGGG
TTTAATTCAACGAACGTAACAAATACGATATTGCACGGAAGTGGGATCAT
CAGACCTACAGATCAATATGTCCCCTCTTCGTCATCTTTGGCATCATTTT
ATTCCATATCATACCTGTGGTACGGTTTGATTGGTTTAACCGTTACCATT
TTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAACGGATATCACCAAACAA
TGAAGTGTACGTTGATGAGAAACTGTTGTTTATTTATAAAGAAACCGAAG
ATAAGAAGATCACGAAGAGAGATGAAGAAAGAGAAGATCCAGTGGAAGAA
AATCATTTTACGGATGACACGCAAAAATGGACAAACACCAAATTATCCAT
TCCTCGTTTCCAACGTTGTCGATTGACATTCGAATCCTTCGAGGTTTTAT
CGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTATCTATTTCCTCGACTC
GTATCATCTAAATCGATTGCATCGCTTAATTTTCTCGTATAAATGCTAAC
AAAGTTAAACAAACTTAATTACCTTAATCGTAATCTGAGCATACTTTCCT
TATCACCAAAGCAGCAGCCAATCAAAATGTCCACAACGTCGTCACAGTTC
ACACTTTCAATTGTTGACTACCTCGTCTTTGCGATCGTCTTGGTGGCGTC
TAGTGTCATTGGGATCTATTTCGCTCGTAAAGGCAAACCCGCATCATCAC
CATCATCGAAAGAGAAGAACGAACGACTAAACATCCTGAGTAAACAAGGA
ACGAAAGATACAAACGAAAATGGTGATAATCAGAAGGAGACTGATGAATA
TTTAGTCGGTGGACGAAACATGCATTGGTTTCCACTTTCAATTTCCTTTA
TGGCAACATACATCTCTGCAAGCTCTTTATTGGGTATTCCAGCGGAGATT
TACACATATggttttcaatatattgtctcTTGTGGTGCACTGTTTGTCTC
AACCTTTTTCACTTGGTACATTTTCATACCGATCTTCTACAGACTGAAAA
TTGTGTGTGCGAATGAGTATTTAGAATTACGATTTTCAAGAGGTGTTCGA
AATATCGGCTGCATCATCATGTCAATTTACATGTTGATTAGCTTGTCGAT
CGGTTTATATGGGCCAGCCCTGGCATTTGAAGCAGTTGGCGGTGTTCCAC
TTTACGTATCTATTACAGTGACTggtctggtctgtattttctaCACAACG
ATAGGAGGTATCAAAGCAGTTGTATGGACAGATTGTTTTCAAGCATTCGT
AATGATCGCAGGTCTACTCGTCGTTATCATCATCGGGGTGGAAGAGGTCG
GGAGTATTgggaagatttttgaaaaagcacAGCAAGGTGAAAGAATACAT
ATTCTAAACTTTGATCCAGACCCCCGTATTCGAAACACTTTTTGGTCACT
AATCTTTGGTGTTGGGTTTACCATCTTACCAGCATGGGCTGTCGGTCAAC
AATCTGTTCAACGCTTCCAGGCTGCCAAATCAATGAAAGAGGCTAGACTA
GCATTATTATGGAACTTCCCATCAATGTTGTTTATCTCATTGCTGGCAAT
GTTAGCAGGTTTGGTGATATATGCAGTGAATGCAGATTGTGATGTTGGAG
TTTATGGGTTGCATCTTGTGGACAGGAATGACCAGGTATTACCTTACTTC
ATCATGCAGAAGTTGGGACATTTGACCGGAATTCCCGGGTTGTTCATGGC
AGTGCTCTTTAGCAGTGCTTTGAGCACGGTTTCATCAAGCATAAATGGTT
TATCAGCTCTTCTGTTGGAAGACTTCATAAGAAAGATTCGACCAAATATC
ACCGATACCAATGCCAAGAAAATGTCCATGTTACTCGcattttcttcAGG
GTTATGTGGCATCGGGTTATCCTTTCTCATCTCAAATCTTGGGAACCTTG
TCTCCCAGATCTCGTTCACAGTGATCGGGACATTGGGAAGTCCATATTTG
GGCATGTTCACCTTGGGAATGATGAATCCATGGTCCAATACCAAGGGTGC
ATACACAGGCTTTCTGTTCGGCCTAGGAACCACACTATGGCTGGCAATCG
GTGCTATTTTCAATCCACCGAATGCTTACCCAAAAGTAGTACACGTGGAT
GGCTGTGCAGGGTTTAATTCAACGAACGTAACAAATACGATATTGCACGG
AAGTGGGATCATCAGACCTACAGATCAATATGTCCCCTCTTCGTCATCTT
TGGCATCATTTTATTCCATATCATACCTGTGGTACGGTTTGATTGGTTTA
ACCGTTACCATTTTGTTTGGTTCAGTTGCGTCCGCAATCTTTAAACGGAT
ATCACCAAACAATGAAGTGTACGTTGATGAGAAACTGTTGTTTATTTATA
AAGAAACCGAAGATAAGAAGATCACGAAGAGAGATGAAGAAAGAGAAGAT
CCAGTGGAAGAAAATCATTTTACGGATGACACGCAAAAATGGACAAACAC
CAAATTATCCATTCCTCGTTTCCAACGTTGTCGATTGACATTCGAATCCT
TCGAGGTTTTATCGACTGTCGTGGAGGCTTTAGTGGTTGCGATGTATCTA
TTTCCTCGACTCGTATCATCTAAATCGATTGCATCGCTTAATTTTCTCGT
ATAA
Gene-mRNA-Prot