Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000047 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000047
Unique NameTCONS_00000047
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1695

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000047 ID=TCONS_00000047|Name=TCONS_00000047|organism=Clytia hemisphaerica|type=transcript|length=1695bp
TCTCATCTGATGTAATGATTTATGGCATGGAGATTCATTTTGGTGTATCC
TATCTTTCATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTC
GTCATTCTGAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTAT
CAAAACACTGATACAAagcaaaattaaatatttccatTTCTTTGCATGGG
GTATCAGTGGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTTTCA
GCTCACCCCATTACCAATATATGTTTCATTCACCTATCGCATAATCAACA
GCATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTTGGTGG
TCGGTGAATTTCTATTACTCAAATGTGTAATACAACTAAAGAAACTTCGA
AATGATTGCAGTATATTTCTGGTCCCAAAagctgtcaaaaatttgaccaa
aacctTCTACAGGATGATTATCTATGGATTAGGAGTGCTGGTGGCATTTA
CGTTACTGGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATGG
GAGAAGAAGCATTCCAAGTATATCAGGTGCAGACTTGAAACTGTAAGCCT
TCCAACATCTCTTTCCAAAGAATGTATTCCGCCTGACAAATCAAGATTGC
TTTGTCTTCATTGCTATATTTTGTTGTTACTCCTCATGTCACTTCTTACG
AGCTCGTGGACATGGACATTTGGAACACTAAAGATCTGGAAGAAAGCTTG
GAAAAGACATTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAA
GGGCGTGGTACCGACGTATTAACAGCAAGAAAATACAgcCGTTTCTACCA
CCAATCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCA
ACCTGACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACC
AAGGTGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGTC
GAACTATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCAT
CTCGAACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGC
ATCTGTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAAT
CTAACAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTACA
ACGTCAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAAA
TTCGGCATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAAA
GATAGCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCC
GGACTTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATG
AATTTTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACG
AAAATTTGAGATAGTGCACCCCTGTATAGAATTGTAATATGAAGATATCT
AATCCACAGATCCAGAACTATACTCCGAACTTACTCAATAGATTAACAAT
TTCGCTACAGAGGACCTGGTCAATGCAGTAGCTTCAGGCGGGGGAGGGGG
TATTTAACTCCCTTTTTAGAAAGTGATCTGTTTCTAAAACTGACTATTTT
CGTTTCTCTTTATCTGAACAAATTCTTTGAGTTTTTAGTTCTAAG
Run BLAST on NCBI

transcript from alignment at sc0000001:1118042..1154382+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000047 ID=TCONS_00000047|Name=TCONS_00000047|organism=Clytia hemisphaerica|type=transcript|length=36341bp|location=Sequence derived from alignment at sc0000001:1118042..1154382+ (Clytia hemisphaerica)
TCTCATCTGATGTAATGATTTATGGTAATGGAAATctttctaattaaaaa aatttctcagtCTTGGTCTTTTCCTTTTGGATTTATCCTGGCTGGTGTTA GTGATAACTTGATAACACTTTTAACAGAATCTTCCTTAAAGAGTCATTTT AAATCAGTTTTAAGATATACGTaatcctaaaaataaaaaatgtgtcATAT CCTTGGGTAGATTTTCATACACACAAGGGTCAGTTTGATACTGATCTTCC TTTGGAGTGACAAATAGATTCGTCTACGAAGCGTCAATTCATCAGAAAAT AGTTATAAATCCTTTCTCCCATTTATAATGTTTTCTACCTTTACTTTGTC AATCATTCTTTTTCAGGCATGGAGATTCATTTTGGTGTATCCTATCTTTC ATATTGATTTACTTCTCCGGTTTATCAACCAGTTGTTGGTTCGTCATTCT GAATTACTCTTGGTACATCTCCTTCCGCACGATGGGATCTATCAAAACAC TGATACAAagcaaaattaaatatttccatTTCTTTGCATGGGGTATCAGT GGATCGTTCACGTTAATGGCTCTTCTACTGCAAGCTGTGAGTACActctg attttttgtttttttataagaagcaatttTAAGTTTATGAAGTAGAGTGT TGGCTTATGATTCTTTTGGCCTTGTATGATATCGGTTAGACTgacacgcc agtcgggctggaacggtatcacgcgggaaaagtgagcgtaggagttaggt aagcgtaggaagaaattttgtcagcggcaagggctgaaagcccgACTGGA GCGAAACGCCAGGAAGGAAAAAATCGCTTATCTGAAGCACGGCCGTATTT CGGCGTTGTCGAAATGAATGAACTTTGGGGGAGATTCCTGAAATGAGAAA TGGAAACTTCCGTCAAAGTCGCTGATCTTGTTATTTTGAATTTGGAGGAG TGAGTGATTGGAAGAAAAATGGCTGACTTCtagtggaaatttttatttga aaagatgttttgtttcttttttcttatttgatgAGTCTCTTCTTTGTGTA TGTTGCTTTTCTTCATGGTTCTCTTCGTGCAAAATTCTTGGGCTCAGTTT TGGTTGTTGGTCGCCCCACGCTAAGTGGAAGGAGACCATTAATCTCGGTG CTTTTCCTCGTCCTTAAGACAAAAAAGTGCAAGTTTAGTCACACGATTCG GAATCAAATGTTCGGGGAATCGGGAAATTATTTCCCGCGTCAATTCTTGC ATCAGTTCTATTATCTCCCTTATATTACGCCACGCAATCTTATCATGTAG CATTTGCCTTACATTCTTGTTAGCTCCGTAGTAATTAGCGTACCTGTTTC ATGAAGTTTTTAAATAACGGAGATAATTGGAAGCCTCGTTGAAAGTTTGA GTGCATCTTCAGAATGAATGAttcttcaaatttaaatttatggTTCTTCA TTGACATTATTCCATTCAAATTACCAAACTTTGGGAAGCTGttgaaaaca aacttttttgaatCGCTCTTGAGGTAAACATTTGGAAGATGTGATGTTGG TTTTCCACAAGAAAGAGGAACGAAGAAGGTTTCAATATCTGTGATAACAA ATACAGTATGTCCCAACCAAAGACCACTCACTACACTGCACTACATATGA TGGCAACCTAACCAATGTAGTAATTTCCAGAGCAAGTATACCATGACTTT ACAATTAGCAGATTTGGTGGGCGTAAAATTCTTAATTCAACCGAAAGAAC ATCTATCGCTATCGCAGTATATCCACCTAGCTAcgtacaaaaaaaattga tatggCATGGATTGATATGTACAaagattgaaagattttgtgtAACCATT CTCCAAGTATTAACTAAAAGTCTCTTGAGCAAAACTACAATTGTTTGCTG TCTGACAGttagtctaaacttaaactcctatatcaggattagaaactagg ctagtcatacctcttttatcttttcctttacaacaatacaatgctgacaa gttgacacaacacatttgTACATGTACCACTTCAGCTGTTTATcgaattt ccaccaatgaggttgccgcatNGGTTAGATTAttaacaaagtgccgtaaa caatcattgaataaaagaagaaaagattGCTCAAGTTtctgggtcaccga taaaccattATTCTCCTCACTATTCTTGTACATAGATATTATcgaactca aaaaaaaaaatctggttCACGATCGTGCCCAATAATAAAGACCATTTTTC GATAATTTTACTATACgatattcaatgggtaaaagttggttaataaatcc aataaccaacgaaaacctattgaatatatggtTTATTATATATCTatagg caaaaaccaaaaaaaattaattgtgTCAATAGCCGAACGTTTCACAtaaa cactcccataatcgaacgttcgaatgtttttcttttttgatgattGTCCT AATTACTTTtagtcataaaatttgtttatgaaatcgacaatagatttatt ttaataaatttctttgataaacaacaagagcgacaaaaaaatcaaacttt gaaagcaaaatttgaaaaaagaaatctaCCGTGGTATAACAGTcttggta tatcaggaattattcaatggctgtttttgcgtacaggtatataataaatc tatatattaatagcggtattCTGTATGTCGTTTTGCTGTCTGTCTGTTAT ACTTTCAttttcgcacgcaatgtttttgttcttccaaaagataactttta gttcttgctccacaaattaatttaacgatattcgcgccgttttataaaga ctttgttttgattgatagattagactttttcttttttttctttcttttct tttgttttatgttttcgaatgtaattaacgaccttatttgatttgagaca ttcgaattcttttcaaaacaaaagaaaccttttaaacagaatctgttaaa gaaaaaaacaaatataaaataaaacacaagaatcacatgacaggtttgtt agaacaacagcaacattaaaaatacattcaagagacggtaaaaactaaaa ttctttcttcgtaaaaagggacgtttaaacatgtatgtcgataattattt tgtaaaaagcaacataaaattgcgctatcacgcttttttgtctgcgtatc ctagctgccttccggggggcctatggttgcgagctgactttcggccctgt ccctcggacccttagcagaataaagaggagaagaaacaaggggaATTGTG Tggattttaattcactttttggaactcatttgaccaaatttctatctttc tggggacaaaaagttgaaatttttcctatttttccaattcttagtgggac tgaagtttgattttccgatttttcaaactgccatgtttcaaaaaaggcac cctttaaggccggcacatacccatacccttctcttgcctaagtaccccct cccccgggctgccttttttcgacgaatcgcgtgtcatgtctactatttca ctccgcttatcttgacgtcaaggttttcctaaacatcaagaactacggca aatataacgcgagcgaagcgagaaaaaaaatataatcgcagagccgtctc ggacgtcgctggtcgacggtatggtgtaatttgggaatgccctttctgtt ttctgatcatttttgccacaaaaatctttttcaaaatatggttaaaagat acgtcacccgggagggatagagtcaaactttgaagagaattcttcccttt aattttgatttcatcgtgacACCataccttcccaacatctcaaaggactt taaatgcgttcagcaaatagctaaaccggcgtgcgacgccgggtaccggc tagtaaaTATATAATACGATAAAGATACATCAAATGGAAATAAGAATCCA TAATGCATTTAAGTTGGGAATCTCCATAAGGTCATCATTAAATACTAACC AGTTTTCACTAATATGATGGGATTGTGTTTACAATAAAACAAGCGCGACA CtgattaaaaaatggaaaatactttttatacaaaaaaatactGCATGAAT AAAAACGCCTTGATTTAGTAATAGGAGCAGAATAAAGTTAATACTTCAAG ACATCCACCTTACTAGAAGAAATAATTTCCGGAAGTCGCAATTTTCTTTC ATCTAGTTTTNCTCCCTACTAGAAGAAATAATTTCCGGAAGTCGCAAGAT CCAATTTTCTTTCATctagtttttttgaaaacagaAGATTTTTAGCCTGG TTACAGAAATATCAACCATAATTTTTGTCTCTACGTTTGAGCATAAGATT AGTTTCGTATCGAGCAACTGaaaaatgtctttttcttttaatcCATCAAT TTCGCACAACGAAAAGATcattttcattgtcttttatgGAGCGATGACGT TGATCGGTAGTTTTGGAAACATCATTTCTATCGTCTGTTTGCGAAGGAAG AACCAAactcaaaagaagaaattggaTTTCATTCTCTTATCCCTGAGTAT TAGCGATGTTTTGATGTCTTCAGTTGTTTTCCCAATGACCGctttgaatg tttactggccTGGTAAAGAAGAATACCCAATTGATCCCATTTTGACGAGA AtaagaagttttttaaaaatagctTTGACTTCTTCNCGATGTTTTGATGT CTGCAGTTGTTTTCCCAATGACCGctttgaatgtttactggccTGGTAAA GAAGAATACCCAATTGATCCCATTTTGACGAGAAtaagaagttttttaaa aatagctTTGACTTCTTCATCTTCCCTTACGATTATACAACTCGCTATCA TCAAGTACANTCCGACAAAGCAGTGTGTGGAACAACCATGCAGTCAAATA AATGGATGTTGAACTAATAACTGTCGAACAACTAAGCGATCACTTGTTGG ACAGTGCAACAGCTCAACATTTTTGAGATTTGTCGAACAAATGTACCGTA GAGGAAAATTTGTCAGAATTAATAACCTcagtttgacaacaaaaatttcT GTAACTTTAATTTACATAGAAgagaattattattattattattaaattaC AAGATTGTGTGGCANGCTTCGAATTATGATTGTACTTTCATGGCTGTTAT GCTTTGGTTTTGCGTCTGCAAATCTTTTTACAGAGAAAGAATTTCCATAT TTCACACAGCTTGTCGTCATAACAACCTTGATTACTCTTCCGTTATTTTA TTATCTGATATACAGAGTGTACAAACAGTCTCGCAGTCGTTTAAGTCAAG AACAAGATCGTACGTCAAATGATCCCTCTATCTTAAAAAGATCGACACAT GCAGAGCATAGTAacgcaaatttagaaatttcaatcTCTGAGAGGATAGT CTCCCTCCGTATTGAAGAATCTCTTCCCAAAGAGAGTTCTTCAAGCAACA CATCTAATGTTGAAGCATCGCATGACCAGCCCACGNTTCTgcaatttttt cacaaattaaatttgtgcACGTCAGATGTTACATTTCTCATGTCAGACTG AAATACTTAATTTTGTTCTTAAATTACTACGGTTTAAAGGTGCTCTTCCA CACAAAATAGAATATACATACATGCATACACATCAAAAGTTTTGCATCAT TTTTTTCTGCCAATTTTACTCAATAAAATCATGGGCCGCAGCTTCACTTT AAAAGTGGTAGGGCCATGgtttagtgtctaaggaggtgCGACCATGGTTG GCACNACAAAAAAGATCTTATTGTTTATTGGCTCATATTTCTTTTGTCTT CTCCCAGGTGTTATTGcaaatcgcttatatagagctgGAGTAATTAAAGA TGGTTTTATGGCGCATTTGGTAGTGATGGTTTTCTATGGAAATTCATGCA TAAATCCTTTTTTGTACATCGTTAGTGATCGGGAGATAAGAACTCTTGCT AAACGACTTTTCACGAAAAATAATTGAAGGTATATTTAAGGTATatgcag tggcgttgtgggaaaatttttctggaggggcccaagtcaattttttaatg gcgccccccccccaattttccaaagtggcgcCCCCGTCCACCagtttcta aatttttactAATTCACtagccccttcaaaaaagctccgctggggggccg TGACCAGTCGCCCGACAAAACAGTGTGTGGAACAACCATGCAGTCAAATA AATGGATGTTGAACTAATAACTGTCGAACAACTAAGCGATCACTTGTTGG ACAGTGCAACAGctcaacatttttgaagatttgtCGAACAAATGTACCGT AGAGGAAAATTTGTCAGAATTATTAACCTcagtttgacaacaaaaatttc TGTAACTTTAATTTACATAGAAgagaattattattattattattaaatta CAAGATtgtgtggcaagaaaactctAAAAAAAGGTCAGAATTTACAATAA TTCTCTTCTCACAACAAAAATGCtgcattttttctaaaattatgaatacG TGtacccaaaaacattttttctgtaaaCATGTAAACATAATTCTGAATTT TTTATCAGAGCTATCTCATCACACCACTTAAATTCTgcaattttttcaca aattaaatttgtgcATGTCAGATGTTACATTTCTCATGTCAGACTGAAAT ACTTAATTTTGTTCTTAAATTACTACGGTTTAAAGGTGCTCTTCCACACA AAATAGAATATACATACATGCATACACATCAAAAGTTTTGCATCATTTTT TTCTGCCAATTTTACTCAATAAAATCATGGGCCGCAGCTTCACTTTAAAA GTGGTAGGGCCATGgtttagtgtctaaggaggtgCGACCATGGTTGGcac cgacgggagaaattttggAAAACTAGCCCTTCTAGACTGCCTAAAACAgg tctttttcaaggtttttacgcagaatttagctgaatcagtaaattttctt cttactttgaaaaaaaagtggtCGGGCGAAGGCCCGGGTGCAACCCCCCC CCATCCCCCGCTGCCGCGGAAAATATACtacataataataatataaatct catgaaaattaaacatattttgattttgaaattctaaTGTACGAGCAATG CACCTTAACATTGAATGGTATGTAAGGTTATCAGCAAATGcaaatttttc ctttaaaatattatttcataCTTCACTCACAAACAGTGAATAGTTTAAAC ATTCTAAGGGGGTTCACTATCTTTAAAATCTAATCAGGAAAAGAGTTTGT TTACATGATGTCAATAAgttcaataataataataatcaaaaactgcagca tcaaaacaatatagggaaaactgaataatccttgtacacttttgataatt gtagaaaactgaagctaCATTGCAAATATTTACCTATCTAAGAATgtata aaataacaaaaacaaagaagattCTTGagtgaatgaatatttttgaaaat ttctttcacagggatgatgatctaagattgaaaaATCaatcctgtgaaaa tggtaactataccacatttctacaagaagttgattttttcttcttcattt ttcattttcatttttctttttttttcaaaactttttgcttGATAATTATC CACTCacaattatctttttaaaaagcacaaaactgctatctaattcgaat tctatcaaaagttacaaaagTTACAGtcttttgtctccgctgcaaattat tttgagacagactttattaaactctttttaattaaaacgaggctcaaaaa tgaaGAACAATAAACAATTAAGAATCTTATAGACCGATTTCTCAGCAAAT TATGGTCAAATTAGTAAAGAACAACATGATAAATGGGAATagaataagaa aaattttaggcttaaaatgtcaaaaataaaaacagctaTACCTCATCAAA AttctactggttcttataaaaagagtgcAAGTGACAAGGAATCACATTGT GCAATGACTGAATGACAAACAGCAGTAAGATTAGCAGTTAGACTGGTATA CATTTTTCCCGCATCAAaaccaggttgctaaggctcgAGGGCTCATATTT GCCATTATTTCACCATCTCTTAAAGAAAAGGCTTTTTAAATAATATAAGT ATGGCAAACGAAAGCCCTTGACCCGATAAGCATAAATTGTATAAATATCA GGGTGGccaaagcaattttttcagaaaatgagctagaatgctcaGCAACC CCAGGGCTGATTGAAAATTGGTGTATCTTCTAAAAATGTGTAGTTAGTTA GCCTGTTGTTAGCCTAGGAGATTAAGGTAGGGGATTAAGGTGCAAGAGTG TCACCTTGAAGTACTCCAGCCAAGATGAAAAATTCTTCTGTTTCTCCATC AGGAGATTGAACTTTTGCTCTTGTGTTCTTGTAAAGAAGTTTGATTGCCT GCACGAGCTCGTTTGGTATGCCATATGCTTTTAATATACTGAACATTCTG ACTCTATGTATGCTATCAAAGGCCTTCCGAAAGTCTAGGAAAAGTAGTAC TGCTGGTAGATTGTTAGACTTCACACCTTCAATAAGTCGTCTCAATGCAA GGATCTGAGACGATGTCGATCTACCTGTTCTTAATCCGTTTTGATTCGGG CGTAGATGGGGGTCAAGAATTGGTTGGATACGATTAAGGATCATACGGTT TACCAGTTTGGCGACAATAGCATTTAACGATATACCACGGTAGTTTCCAC CTTTGCTGAGATTGCCTTTCTTTGGTACTGGGATAATGTTACTGATTGAC CATTGATCAGGTTTATTAGCATTCATGAGTANCGCCTCTCTTTGGTACTG GGATAATGTTACTGATTGATCAGGTTTATTACCATTCATGAGTAGATCGT TCGCAAAGTCTAGAAGAGGTTGTTCAATATTGCAGAGCTTTATTACTTCA GGAGGGATGTTGTCGGGTCCTGACGCTTTCCCGAGAGTTATTCTTGATCT GGCTTTAACAAGCTCATCCTGTGTAAATGCTCCTGTTTTGAAAGGTAGAT CGCTGAGAATGGTTTTGATTTCGCTTTGATCGTTATTTATAATAGGCTCA CGTCCAAGCAGATCTTTAAAGTACTTATTCCAATTATTGACACGTTCCTC TTTATTTTTGCCTTCAAGTATGCCTGATTTCTCATTCTTACGTCCGGAGA TGCTGTTTATTGATTTCCATGCTTCACGGTGCTTTTTAGAAGGGTCCATC TCTTCAAGACGACGGATCCCGTTGGCAAGCTCGTCTCCCATCACTGCTTC GTAAGCTGTTTGAAGTGCCGCTTTATTTCTCTCTGAAGTTTGCATTCATT GTCTGGAGTTTGAGATTCCTGGAAGATTTTGAAAGCGTCTTGAACATCTT TTCTTGCCTGGACTACTCTTGGGTTAGAAGATGTTTCATTTTTGTGTTTA TTCCTTTTTCTGGGTATGAGGCTTTTGGTTGCCTCATCATTGGCTTGGAT GAAGAAGTCATATCGCTGGGTGGCATCAATATTGTCATTATCATCACACA GGACAGCAAATCTATTTTGCAAGGAAATGGAAAATTGTCTTTGTAagtct ttactttttttcattaGTCTTGATCTTGAGTTTTGCTCTTAGAATACGGT GATCAGAGCCGATGCTTGCGAATGAGTTGTAGGTGGAAACGTCTTTCACG TAGTTAGCCCATTTTCTATTGACAAGGATATAGTCTACTTGCGATTTTGT ATTTGACATGTCAGAAATcatagtgggcacccccccCTGTATTCTGGGGG GGTtgaggattttcagatttttaaaaataggtgggggttgggttgatgag aaatttcaggtgggggtaaccctatgtaggtgggggtaacatttttcagg tgggggttgcttgtcaagttttttctttctctattACAGAACAAATATTT CACTTTGGACACAGCTGCCTAGAAGAAAGTATGGTAGATAGGATAGAAAT AAGCTAGGGTAGAAAATATacaaataaaattagaaatccaAACCTAAAAG AAAACTAAAACTAATTTTAACGAGTGAGTGTTCAAACAAAGCACATCTCT TTATATCCATTATCTATGACATATGTTTCCTAAAGGAAAAACGGATaaac tgaattttcaggtgggggttcgaagattttacaaatttaggtGGGGGTAG CTGAAAAAGGTGGGGGTTGGGCTGATATgagatttcaggtgggggtaacc ctatgtaggtgggggtgacctttttcaggtggggcTTGGAGGGGTGTTGC CCACTATGGAAATATATGTCCATAGTCTACTTtgctttttctgaaatttg atgtTTGTGATCTGCATTTTGCATTCCTGGGAAAGATTGAGTAGCAGTTG ACcgttattgtttgttttttcatgaTAAGTAAACTTGCCGTCATCTTTAC CGATGTGTCCGTTAAGCTCGTGGTCCACTTAGCTTTTTTGGTCGTAGAAA AAAATTGCGCGtaagagaaaatcaaaacaaaacaattgtACATGATAAAA ATAACACACAATCAGTATGTTTACCTTCTCGCTGATTGGCTACttcaaaa agaacaatagaaaagacGCACAGCTTTGCGcacaaagttgaaatttttca actttcaatcaaaaaagttCACGCCGTTCATTGCGACAAGCCTTGAAggc ttactctcgggtacctaatagccgggggggggcgctaattaatttttcga aaattttccacccaggacattcttattccaaccccccccccccgtttatt aatttttatgaatattttttctgaaagtaccctcttttgccctaattctg ccgTATTAGCCttattttcgaacattttccacccaggacattcttatccc accccccccccccgtttattaatttttatgaatattttttctgaaagtac cctcttttgccctaattctgccgTATTAGCCttattttcgaacattttcc acccaggacattcttatcccaccccccccccccgtttattaatttttatg aatattttttctgaaagtaccctcttttgccctaattctgccgTATTAGC Cttattttcgaacattttccacccaggacattcttatcccaccccccccc cccgtttattaatttttatgaatattttttctgaaagtaccctcttttgc cctaattctgccgTATTAGCCttattttcgaacattttccacccaggaca ttcttatcccaccccccccccccgtttattaatttttatgaatatttttt ctgaaagtaccctcttttgccctaattctgccgTATTAGCCttattttcg aacattttccacccaggacattcttattccacccccccccccgcttatta aatttttagattttttccaacccccctgcttattccaaaccccccggcta ttaggtacccgagagtaatttatttaatttatgcaataatcgAGCCGTGC ACATCGTGCGGCGACCAAAAAAACTAAGTGGACCACGAACTTACGTGGAC CACGAGTTTTAAAGTCACCAAGCACAAGTAAAATTTTATGCTTTGGTACA CTATTGATAGTGTCTGTCAACTCATCGAAGTGGTCAATGGCATCTTGGTA CCCTCTTGTGGTGCATAGTTAACGATGACTTTGGTTGTAGGGTTGCCATT AAACGTTGCTATGAGGATACGTTTGTTCACATACTTTACACTGGAAAGGA CATTCTCAGCAGCTTTGTTTACGAGTAGACCTACTCCACCGTTAGCCGCA TTTTGGGTATTCCTCCAGGCCGATTGAGTGATCAGTACACATCCAGGCAA TTTGGTGTAGTTTATCGTCGTTTTCTCTGTATCAGGGTGGACAATTTTGT GATGGACGATTCCGAGGATCGAggtgttcgagttaagaaaaaTTTTGGCA AGTTCAAGTCGTTTGAATTGATGACGTATTGTTCTTACATTGAAAGTCGC AATGTAGCTATAAGTGtattggttaaaaagaggtTTTGAGCTTTGATGAT CTCGTCATCCGATGCAGCTCGTCCGAAAGGATTTGGAGGTACATCATCAT CGTTCCCATTTCTGGTACAGTCATTAATCAAAAAGCTTGAATTTGTAGGG GCTTGAACCCTAGTGCTGTTAAGTCGTGAATTCATTTTGTCTGTCGAATT GCTAAATACACATAAGGGGCGCCACTCCACTTACGGTTGCAGTGCCTTTT CTTTAAAGGTTGAATCTCCTCAGCGGTGATCAGTTGTGATTCATACGCCG AGTAGAAAGTTGTACAAATCAATGATATCGGTTTATCGATAGAAGCATTT GTTCAAGACACCCTCCCGCATTTCAAAGGTGTGAGTTACATTCCGTCAGG CCAACCTTTGACCTGTTCGGCTAGGTTGAACCTACCAGGAGACCTTGAGT TTTAAGAGCCgagaaattttcttaaaatgttcttattttcaccattttgc gaGTATTTTTGTGTATCTTCCCTAACAAAGTAGGTGTCTTAGAGTCGaga aagcctttaaatgttcttataaccTGCTTATGATATTTTAGTCAtcgatt gttcttataaaaacgtgaaCAAATTTAAGTGACATGAAGCTTCTCATAAA AATATTACAATTTTGATAATGAAAATTTCCCGACCACCCAACCGAGAGTT TCGAATAGAAAAAACGAGTTGAAAAGTTCGAAAGTAGCATAAgcctgata cataccttatactCAGTGACTAAATGGAATGagtatttttttatctgtaa tgtTGGAAACGAAAAATACATTTCTTGATGAGTTATGCTAAATAATaact tgttgtttttgtatgaaaaaattCACGCATGCGATGTAAAAGGCTTCCTG ATTTGTCTCGATCAATTCAAATTACATATTGAAACACATTGTGGTTTTGA TTGAATCAGTAAGAAAACCTTGTTCACATGTTCTCAATCTCATGAATTAT TCAACaagacaatattttttttttttttacttctcttttatcaccattaA CATTATTGGTATATATAAAGCTAAAAATATAATAACAACAACTTTTcgtt ttaaaaatatgtacaaagataAAAATNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTC CTATTAATATTTCTATTAATAATCTCCCTCATTTCGTTCCTGCATTCAGC CATGTTCCAGTTAGCAATCAACAAATTTAGTTTGCTAACAAGTTCTGTAT CCAACTGATCTCCCGTATTAACTTTAAACGATTTATGTCTGTTAAGGACC AAGTTACATATATCAATATCTTCACGATTGCATATGTTAAGAATTCCTGG AATTATTGAGTATTGACGGTCAGGTGTCGTTAACAGGTTGAGAAGGTATG CAGATGTTTGATGATTCTTCATTAGCATTGTTAGAAGATTTAGTTTCCTG TTTTCGATGTACGGAATGATGTCTGCAACTCCAAAAAGTTTGTTGAGGTC ATTAGAGCCATGTTTTGAATAACCTAACATGTTTTTGAAGGCCGAGCGAC ATTGTCGGTTTAGATACTCAAGAAACGATTTAGAAGTGTTAGTGATTTCC ATTCCATAGAGAACTTTTGGAAGGACGATTGATTTGAAGATGTTTGCTAT GATGTTGGGATGCATTTTCCTGACTCCACTAGAGATGAGAGAAGATGTGA CGGCCCATAGTTCTTGGATACGATTTTCCTGGTGTTTAGCGAGAGTGATC TTCTTCGATTTAGTGTCCCATAAAAAACCCAGatgttttaaggttttttg GGGAGATATTGATTTGTCATTCATTGAGATACTGGGATTGTCTATTGGGC AATTACCAGATACaataaattgtgtttttgtatcATTGAACTTTAAGCCA ATATTACCGCCTTTTTCCTGACAAAGAGATATCATTTTCTGGAGATGTTT TAGATTAGGACTCAGGAGGATCAGGTCATCAGCGAAGGCGATAATTGATG TGTTGATGTTAGGGTTTAAGAAGGTTCCAACGTTAAGATTAGTTATCTCC TGAAGGATATCCTCGGTGTAGATGTTATATAGGTATGGGGACAGGATTGA CCCCTGTCTGACTCCTTGAGATAGAGAGAATGGCTTGGAAATATTACTGT TGTATTTGATTTTTGCTTCTCCATGACTGTAAAGTTTTATAAGAAATTGT AGCACCGTATTTGGAAGTATGTTTTTCAATTTGAGTTTGTTAAAGAGTTC AAGCCAATTGCACGAATCGAAGGCTTTCTCTGCATCCAGACTACATATGT ATACAGGGGTATTTTGGGTATTATATTTTTGAATAGTTTCATTGATTAAG AATTCAGCATGTAGTGTAGATCCGTCTGATGAGAAACCGTACTGGTGGTC TGCGTGATGCTTTAATTGTGGGCATTTCTGTAAAATTACTTGTTCGATTA ATTTGGTTAATATTGGGATTAAGCTGATGCCTCTGTAGTTGTTCGGGTCG CTGATTGGTTTCCGGTGGGATTTGATGATAGGGACCAGGTGGGATGTGGC CAGTGATTCAGGAAAGTGTTTCGAGGTTAGAATTCGGTTTATGGTTAGTG AAAGAAATGAGAGATTCTGGTCGGAAGGGTGTGTAAAACCGTGGATAAAA TGTTCAGCTTTGATACCAAAAGGGTCGTATGCCTTGTCTTTGTTTAGATT GTTTATAGCAGTTAGTAAGTCATTTTCGTTTACTAAAAAGTCGATTTCAT CCATTTCTTGTAGATCAGACAATAGACTATCGAGGAGGTCGTTTGTACGA GTATTGTTGATCTGTGCTGTCCTTGGTGTATTGAGCAGTGTATCGATTGT AATATTGTAATATTGTTAAAGATGTAATATTGTTAAAGCTCCGtttacat tattttttttcCTGTGGCACCAATGAGATATTATGAGTTGTAaaggtact cttaggtgccaaataaacgacCCCctctgcttgttaatttttcgattttt tgccaACCCCCCGGGACCTTATTAGgatccccccgtttattaatttttga aaaaatgcccagctaccaaaaggaaagttccttgttttactctaaaaagc ctaaatttagtctattttgaccctttttagggtttttaaagATCTATTTT CCAACCCACCGGTAATTAGCCCCccctcccccgtttatttaatttgaaaa atgtttcccacgtttttcttttttagacctTTAGTTTTTTCGCGTTATTG TTCTCGTTATGTTTCTATTCCTTTAGATTTTTGAGTTATTGTTTGTTCCT TCACATTTTTTGATTCGAGTTTTAAAATtgataatgacgtcattacTCAG TGAAAGTAACTCAGGGTTGCGAATTTTAATGCATtctaacctgtagattg ccaatttcgatcttaacctaagaataccgtgagaatacctaaaaatttat attttgggatgattttcgccaaaaagttaagaatatccatgatgaaacga aaaaacaccattcttataaaaaaagcgtgcacTCTACAGGTCGAACCCAA AGAGTTATTACTTTTGGAACccagtgtttttttataagaacatttaggct gtcTCAACAAGTTTTTTGGtcccaagcaaagatttggtaaaaaataagaa cactaCAAGGACAGCCAAACTGAAAATTGACGAGTTCAACACCCGGGGGG GGtgtacccttgccgaccgatgggggtgctccgctgaggttcgaaaaatg gaccctacgtgggactcaaaAATTTAGCCGAAATTAAggaaaaaaagtga ccctgaatggtaCTGAattggactgaaattccaaaattttcaaagaaagg caccctacgagagactgatttttctattttggtgtttttgcgactcTACC TTGGACtggtggaggttaaaaaagaaAGGTAGCCTGACCCCgtaacccta gtaccccctccccgggGCTCaacaaaattagtttcaatcttCTATACATA GCTGTCCATaacagtttttttctcaacttGGAGATTACAGctaattttgt ttgatttgaagtgCTACGTAGAAAAAGGTTTGtagaaaaagttaattttg taATGTGTATGGCCTTTTCAAATTGATAGATTTGattattcaaaaattta tttttggaaaaggtGCGGTCAATCCCAGAGGGCTTAGGATCGGGCAGTGA CTTTAGGCGCCACCGAGCCATCACGACTGACCAAGGTCGCTAGCGTTCTG ACGAGAGAAATTCTGGATAACCAATCCCGAACGGACCACGGTTTAAGATT GCTAATTCTATTCTATTGCTTGAAACACTTTTAATATGTATTCTGCTTGT GGTTTAAAGTCTGAAGGGAAATACTGTTATTTTATCGCCCAtaatatatt tttagttttcccaCTTCTCATGCAGTTGTTttagaaattgtttgaataat tAAACACCAAGTGGGGATTTCCCTTTTCTCGTTTACTTTTGAATGTTGAT TGTTCCTATGCAAACATCTCTGTAATCTCCGGGCAGATTCTGATATTCCG TGCACGGTACGTTTTCATTCTAAAGACCATGGCTCTGTTAGAGAATCTGT CCGGATTAACACACCGCTTTGATCTCTTTCATCCAAAtttgggatgaata ttaaatgagttTTTGAGCGATTGCAAAACAATTGcaacaaaatcaaatgt ttGCCAGGACAAAGGACTCCCGTACACTTTGTCCCGTCCCCCCCGGGCTC GGGGGAGTACTTATGCCGCCCTTAAGGACCCAGTTTCAGAAGCATTCTCG AAAAAAGGACACCGTGagtaataaaatcttttaaaggaTTTGAATCCATT CAAAGTTAGCAAAGAAGTTATTATAGAGGAACATTTTTTCATGGGAATAA GATATCTTATTATCGAtgtactttttttctatgtttaAGCTCACCCCATT ACCATAACAAAACATAAAGAACATAAAAAGTGCTTTTAAGAACATCTAAG CTGACTTATACGTTTGAAAAACATAAGAAAATTAAATAGACATTGCTAGC CTGAAAATTGATGAGATCAACAAAAAATTGCCCAAAATCTTCTCAACTCG tacatttaagaacatttttagacttaaaattcataaagttAAGATTATCT GTAGGCTTTAAAGATTCCGACGTTTTTATAAATCAAGTTTTTTAAAGGTT GTCTAATATTTGTGAAGCTTccagatgttcttaaccttttaaGTTTTGAG ccagaaatgttcttaaaatgttcttatttttttactattttatgagtatt tttgtgtatcTCCCTAGAAAATTGGGTGTTTTTAGAGTCGTTATTCAGTG ACAGACATGTTACGCTTGtcgtaaaaatatttcaattttatttatgaACA TTACCCGACCACCCAACCAAAGTTTCGAGAAAAAAGCGAGTTGAAAGTTC GATAGTAGCATAGgcctgatacataccttatgcTCAGTGACTAAATGGAA TGAGTATTTTTATCTGTAATGTTGGAAGCGAAAAATTCATTCTTGACGAG TAACGCTAAATAATAACTTGTTGTTTTTATTCACGCATGCGATGTAAAAA GCTTCCTGAAATTTGTCTCGATCAATTTAAATTACATATTCAAACATAAT GTGGTTTTGATTGAATCAGTAAGAAAACCTTGTTCACATGTACTCATTCA TGAATTATTTAACAAGACAGTATTGTTAAAGCTCCGTTTACATTACGAGA TTTATCCAAGTGTTTTTTTGAGAACATTTATGCTGACTTATACGTTTGAa acaaataagaaatttaaatagACATGGCCAGCTTGAAAATTAATGAGATC GACAAAAAGTTCTTCTCAACTCTCAAATGTACAACCAATTTTAATGTAca ttttaaagaacatttttaggcttaaaatttaTAATGGAAAAATTGTCTGT AGGCTTCAATGATTTCGGATGTTTTTTCAAAACAGGTTTTTTAAGATCGT CAAAAGTTTGTGAAGCCTGCGGatgctcttaaaatgttcttatatctTTA CCTTATGAGTATTTTTTGTGTATCTCCCtaaaaaatttggtgttttcGGA GTcgttattaaaggttttatttttacataagtgttcacGTTTTATATcag gcacatatttcatatcaggacaatgtctgcctattgttatattatgctga tataagcaaaaaatatactctttttgaccaatcttgctccacatccgtgt cagttcaatgtgaaaaagcttgtaaatcaaaattgatgagtgaGCAAACG atttcactcttatttaaaaacaaaacctttaactcaGTGACAAACATGTC ACACTCGTCNatcactcttatttaaaaacaaagcctTTAACTCAGTGACA AACACGTCACACTTGtcgtaaaaaatatttcaattttattgatGTAAATT TCCCGACCACCCAACCAAAGTTTCGAGAGAAAAAACGAGTTGAAAAGTTC GAAAGTAGCATAAgcctgatacataccttatactCAGTGACTAAATTAAT TAGAGTATTTTTTATCTGTAACATTGGACAAGAGAAGTTCATTTCATGAT GAGTTACGCTAAATAATAGCTTgttgtttttatatgaaaaaatattcacG CATGCGATGTAAAAAGCTTCCTGATTTGTCTTGATTAATTCAAATTACAT ATTCAAACATATTGTGGTTTTGATTGAATCAGTAAGAAAACCTTGTTCAC ATGTACTCATTCATGAATTATTCAAAAAGACAGAATTGTTAAAGCTCCGT TTACATTATTCATTCTCTTGTGGTACCAATGAGATATAAGTTGTAAAGGT ACTGAAAGGTCGATGCTCGGAAATCCCGAATTATTCTCATATAAAAacaa gttatgacgtcattctcaatttttatttcatttcccAACAAGTTTCTTGG TCCCAAGGAAAGATTtggtaaaaaataagaacactaCAAGGACAGAAAAT TGACGAGCTCAACACCGGGGGTGTaggactcgttttttcaaaaattttgc tgaaatttgggaaaaagtgaccctgaatgagactgaaattccaaaatgtt ctcaaattttctactttctccccaaattttcctaaaaaggcaccctacga gggactgatttttctattttgatgtttttgcgaccctagtCCTTGGACTC GTGGAGGCTAAAAAAGGTACAGCTAATTCTGTTTCATTTGAAGTGCTATG TAGAAAAAGGTAATTATGTAATTTGTATGGCCTTTCCAAGCTGATAGATT tagattattttaaaaatatatttttggaaaaggtgCGGTCAATCCCAGAG GGCTTAGGATCGGGCAGTGACTTTAGGCGCCACCGAGCCATCACGACTGA CCAAGGTCGCTAGCGTTCTAACGAGAGAAATTCCGGAGAACCAATCCCGA ACGGACCACGGATATTAAATTGTTAATTCAATTCTATTGCTTGAAACACT TTTAATATGTATTCTCCTTGTGGTTTAAAGTCGTCTGAGGGGAAATACCG TTATTTTATCGTCCATAATAGATGTTTAGTTTGTTTCAGACCATTTGGTT TTCCCCACTTCTCATTCAGTTGTTTTAGAAATTGTCTGAATGATTAAACA CCAAGTGGGGATTTCCCTTTTCTCGTTTACTTTTGAATGTTCATATGCAA ACATCTCAGTAATCTCCGGGTAGATTCTGATACTCCGCGCACGGCACGTT TTCACTCTAAAGGCCATGGCTCCCGTAAGAAATTCTGCCCGGATTAGCGC ACCGCTTTTAtgtttttcatccagatttgggatgaatattaaatgagctt ttgagcgcaCTGATTGTCTGAAGCAAAACAATTAAAACtcgaaaaaataa tcaaaaaccaATACCATAGAGGCATGTTTCTCAGGACAAAGGACTCCCTG GGACCGGGTAGAGGGTTACTTAAGCAAATGGAGGGCACGGCTATGTGCCG CCCATTGGCCCAGTTGCAGAAGTATTCTCGAAAAAGGACACactgtttat taaattttttaaaggaTTTGAATTCATTCAAAGTTAGCAAAGAAGTTATT ATGACGGATCATTTGTTCATGGGAATAAGATATCTACTTTTTTTTCTAGG TTTCAGCTCACCCCATTACCAATATATGTTTCATTCACCTATCGCATAAT CAACAGCATCTTCATGATGGACTGGTGGCTTTCCCTTTCACTGTCTGTTT GGTGGTCGGTGAATTTCTATTACTCAAATGTAAGTCTtgtatgtttatat tttttaggCCGGAATCGGTTTTTTCAACACAGTTGAACAGTCGTTTTTCG TACTCTAAAGTCGGGGAAATAAGGGAGAAATAATAATCTGGAAAAAGCCG TGAGATTAGTTTGGAAAAAACTATGCTAAAATAACGAAACAAAGTGTCAT ATTCGACGTATTTGCAGTATCTGACACATCCTACAGCCTAGCATAGCCTT TTCCTATCCCACAACGCGAAGCTGGTTTATAACGTTTTAcgtcttttgtt ttttaattgaattgaCATCAGTTCCTTGAAACATAATACAATGACTTCAA AAGTGATACCAATCTCCCCCGACgattatgtgtttttttttttgcgcagt ttaaaataaattataaactTGGTTTTCGGGAAGGCACTGGCTAGGAGGGT ATATTTGTAAAAAGTTACAGACGGGACAGTCTCAAACAAGAAAGTCATTT CCGTTTGGTACAGGTAAAACTTAGTCTAAACTTTTGTAGTATGTTACACT ATTTTCTACACAAAATGATACGGGAAGACCGGCATCGCTTTAGATTTTAG AAGTTTTACCGATCTCCAAACTGGCAAGGTCGTTTTTCCGTTGATTTAGC TAATTTTTGTTTCGTCTCGTTGTTCGATGTTGTTTTCAACATCTGTTCGC ACGGTTGTAAAAAGTTCGGATATTTTTCAAGGCGAAAATTAATAATTGAC GATCTTTTCATATCGGGAATGTTTTATCATGTGTCACATTTAAAAATATC GGGAAAGGTAAcgattgaaattgaaagtgaatgAAATATTTACTTTACAG TagatttattcaattttttatgtctgttttttttttctaacgtGCGAATT CATCTCAATCATATCGTGATTCCCAGTGAAAAAAGTATAATATTTGACAC ATTAACATTTAATTCGAATTGTCAAGCCTTGAAAATAGTTTTATTCTTAA AACGCGTCGTCAGTGCCGaattttgcgaaaatccgtTCTCGCCAAAAATG AGGTAATgcataacaaaaaataaaataatggtTTATGAGGTAggttattt tcatttgaaatttgTCACGCCAACTGGGTAAGACTACCGCCAACTGGGTA AATTTAAAGTGATTTTCAAACCGTTATTGATAAAGAACTTAATCaaaggg aaaaaaataaataactgtTTTGTACTCCCTTTGGTAGTAACTATTTGAAT GCGAAAAGAAATCCCAGCAAATATACTGCTGATATAAATAAATGGGAATC TTTAAAACTCACACCAACTGGGTAACCCGCTCCTACTGGCTATGAAAAGC TTTccattttaatttgaaatttaggAGAGGGTTATTGATGTCGCTTAAAA TGGAAATGAATGTGCTACACTTGGTGtctctttttttatcttctactata ccttaagggaagagattttggcggaaagaaattttggcgaatttggcaaa TTGCCTAAAAATAATGTCgacaaattcgccaaaatttctctccgtcaaat ttaattttatagTTCAGGCCAAAcccaaaataaattctcgccaaatttaa ttttctttcaatttagtctctatttctcctaaaaccctttttttcctctt ttttcagttaaaatattGACGAAAAATGGAttgttcgccaaaattaattc tcgccaaatttagaaattttattaaatcgccaaaatgAATTAcgccaaat tgcaccaaaattggcgaattggctcattcgccaaaatttcttttcttaag gTAATTAAAAGAAGGAAGGGAGGGGAAAgaatcattttcttttgttttta ggaTATTCTATTTGCGAGtactttttgaaaacattttgtgAAATTAATAT TGATCAATTACTTGTAGGTGCTAATGTCTAATGATATGGTTTTGATGTAA TTTTGAGGTTTTTTGGGttgttaattaatttttttatttgcttaATGTAT CTTCTCAATCATCTTGAGTGCTTTTTCATTACAGGGACCACCATCTTTGA AATGAAatagtttttataagaaccaactAAATTTAGCTTCGGCTTCTCTT GTATTCTCGAAATCTTTAACTTAAGTctcgaatgttcttaaaatgttctt aaaatactCTGTTTCTTTACTAATTGCTTTGGTGTTTTCTGGAATACGAG ACTAGGattattctaaattttgttCTCAGgttcaaaacaaattatataac tattgttcttatttaaaatcttttttatcaaaaagcaacTCCTTTTTGGT TGAGACTTCCTTCCGTGTTCACACTTTTCACAATCAAAAATAACATACAG TTTCCTCCGTTCCcatccattcagacgtacataTTACATATAAGCAACAT TACATAAAAATTCACCAAACTAAGAAGTGATAAGCAGAATCACTGTACGT ATGTGGAAGCCATGAAAATTGAGTAAATCAGGAGAACCTAGTTGGCAGAC AAGCATTTAACCCGTCTTTTGACTTGTTCATTTCAACAACATTATACAAA CATCTAATCAAGTTTCCTTCGTTGGTAATTGACCGACCAATTAATGACGA TGTGCAGTTATCAACATAccaatttatttttcatatctatttttcttcaa atctcTTCTATTTACACCGTTCCGCAAATATTCACCAAGGTTGTTGGTGG TGAAAACGTCAGGATTGAAGGTATTGATGCAATTTATGAAAGATCAGTAT CCAGTCCAACTGAATGTTCCCTAATATGTCAACGCCATAAATGTGTTTTC GCCCAAACCGTACCTCAAGAGAAACAGCCAGGTCTTAAATGTTCGTTATT CAGCAATATTGAAGATGTCTCGGCTGTATTGGTGCATCATAAAAGCGCCA AGATTGTAAAGTTGAATGAACAGCTTTCTTGCAGCAACGAAGATCAAGAT CCGATTCTTCCACTAGCACCATCACCGCCACTAAGCAGTTTACCGGAATG TCTTGATTGGTATGAGAATGGATCTGAAGACGATGGTGTGTATAACATAA CCATCGGTGGAAAATCAACTCCAGTCTATTGTATAATGTAAGATCAACAA AGTTTCGGAGCAGGTAGGTTCCTCTTGAATTTTTACCATATATCTACTAA TTGGAATCTCAAATATGGATTTGTTTAACTGGTTCACAGTCCCGATAGAA AGATGACGTCGAAAATCAAGGTTGTTTGGATCACAAAAGTCCTACAAACA AACTTCCAATCCTTTCCCTGTCTACAATAACAACGATATTAACAAAGAAG GAAACGGAAAAAGCTTTCTCTTTGCTCACAGCTTGTAGGTACTGTAGAGA GCAGAATTAAACTTCAAAGTCTTATGAATCGCATCATTAGAAAAGACTTA ACGGGGAAATAAAATTTCCGTGGTTTAAGAAGATGGGCGTTTTTTAAGAA CAGATATTCGCAGGTTGACACCtactttttaatgaatttcttttcttcaa tatcttaggaaattcatgattttttaattttcaatatttctgcGAAGCTA ACTTTTACGGTAGAAACCCAAACTGCACCGCGAAAATTGGTTCCATTAAG TTATCTTTAATGATACCGATTTTTCAGTGTAATTTGCTCTATTGTTTTGT TTAGGATGGACAGTTTTCCAGCGCCGTAAAGACGGGTTTGTCGATTTCTA CAGATCATGGTTGGACTACAAGGTTGGATTTGGTAATATCCATGGTAACC ACTGGCTTGGTTTGGAGAAGATTCATCAATTCACCAAATCCAAACCAACT GTCGAAGTTCTCATCTTTGCTAAACGATTTATTGGCGATACAAGATTTGA ACATTTTGAaggtacagttgacgctctctaattcgatcttcaaggggatt ttgaattttcatcgaataagggagcttatcgaataagagagcgtcgttta tgagagtttcttgttgacggggactttaaatatcatcgaataagggagcc tatcgaatagtagaacgtcgaattagagagcgtcgactGTAATGTAAATT GTTTGCTAAATGCGTTTGAATTTTCCACTGGTGGTAACAAATTTCTTTGC GTTCCTTTGCGGGGTTTTCCATCATGTATtccttctttttgatttttaac tcATTTTATTAACAGAAACCCGACAAACTCAACTAAAGGCCCGTCACTTG CCactaatttttaatttcaaactaACTTTGCTTCAACTattgttaaaggt tttatttttacataagtgtccccgtttcatatcagacacaatcaggacag tgtcttcctattgttatattatgctgatataagcaaaaaatgttgttctt ttcctctttctgaccaatcttgctccacatccgtgtcaattcaacgtgaa aaagcttgtaaattaaaattgataactaagcaaacgatatcactcttatt taaaaacaaaacccttaactttgtttttaccttttttatcaTCAAGGTTT TTCAGTGGATGGCGAAATCACAAAGTACAGAATAACAAGTGGTAGAAAAA CAGGTGTAAATTACGGGAGAGATTGGACAGCTTTGAATGGGATGAGATTC AGCACATTCGATTCAGATAATGATAATTTTGGAGATAGTAATTGTGCCCA AAATTACCCTTCAGGTAAATTGAAAGACCACTAATTCATTTACTGTTATC TACTCTTAGgctccaaataaacgggccccacCGCTTGTTAACTTTTCGCC CCTTATTTCGCtctaaaaagcctgattttaacctatatttaccttatttt ttggTTTTCAGAAGTACGATTTCCAACctcccggcaattaggtcccctcc cgtttatttggaacctaagagtacttcgGTAATACTCTCAGCTCAGATGC CTGATAAACGGGGAGAGGGGTTTGAATAATCAGGGGGGGAGCTAATTTTC GAGGAGGTTGGTAATTGTACACATAAATGCCCCCAAAATAAGGTAGTTAT TAGCAATTTACAGCGCTtgttttaaaaaccttttttggttGTGTAAGAGA ACGATGGACAGATCAGGCCTTATAAGAAGAACAAGCACTCGCTATCCTAG GGTCGAGAAACTACTGCGCTTACCCGACTCTGTCAACTCTTGACGCATAG AGCTTCCGGTGCATAATAACtataaacgctttttttataagaatggtgta aatccatttcatcatggatattctcaacttttttgggaaaatcatcctga aatattcttacagcattcttaggttaggatcctaattcagactagattta acatttagtacatacgtctcaagcataaaatagcatttttgtgaaaggag tgagccttacatGCTGGTAaatggcaatttataattgaaaattctctaaa aatgacagacattcttagcttgagtagaaAAATTCCATTAaaggtgatat tcttagcatattcttaatatataatttttggccattttcatcatggagat tcttataaaaaagtgtatccttataaaaaaacacgtgtaCTCTAAGTTAG CTTGATGGGATTTGAAGAGGGTTACAAACATAAGACCAACTTTGGAACGT TTATTTTTCATAGGTTGGTGGATGAACAGCTGTTTTCCAATCAATCTGAA TGGTCGTTACCGATCGAACGGAGGTGTACCATCATCGTCTCAAGGGATCA TTTGGGAAGAATTTGCAGGTCCTGTTGAATCTCTCAAAGAAACGCTAATC ATGATGAGAAGTAAAAAAGAAGAATCGCTTGAATCGTTTGAATCAATTTC AATCGATTGATGAATCGATTGAATCGTTTTCAATCGATGATTGATCATTA TTATTACACTTGAGTgtatcttaaaatattttattatgtATTTGTTATTT ATGTATTTATGTAAGCAAGTTCCTTGATGTAAGTGAGCCGTGATTAGATA AGATATCCTATCTAGGTCACATGAAATTCATTACCATAGAATTTCAGCGT TTGACCAATCAGAAACGTCGCGGATAACAATAGCAATAACTTTTTTTACT TGGAAAAagcttaaagcactccatctTACCCTTCGAGCTTTACAGAAATT TGTGATTTGTACTCTTATCTTCACAAACGCACAATGGCAAACTTCTATTG ACTAGAGTTGTTGAAGGTTTTGTTTTACTATATTAGTGTTCCattttcat atcagacacatatttcatattgggacagtgtctacctattgttatattgt actgatataaaaaaaaaatttcttttcttctttctgaccaatcttgctat CTTGCCAATtcgaaaaagcttgtaaattgaaattgacgagtaagcaaaca atttcactcttatttaaaaacgaaACCTTTAAGATAAATTCGTGTTATAT ATAGTAATATAGGTGTTATGTGATAATGCAATAAGTGTATGTTACAATAT AATGTTAGTTCGTACAATGGCTTTTAGTTTTCCTTACCATAcattatttc ttaaattcaGTCGTCCACTCGTCTAAAAGTTATTATAACtgtgaaaatta aaataacTGCGCTTCAGCAATTCAAACTgaatttatgtatttgcactttt gaagacggtagagtgactgaagcgttTTGGAATAACCCACAGTTCTGACT CGCAATATCGAGGACGGGAAAGGTGCTGATtaaccgtcgtcctcagttgt tcaggatctagtcaaattagaaccttaccgtctccgtcgcagaaaagcAC ACATACTTAAACTcgggaaaataaataaaaaatgaccaaattaCACGCGA AGCTGTACGATGACGAGCCAAAACTCAAACATGCTCTCGCCTCGCCTATA AAGCATTGAATTTCGATGTTTCCCATTAGGGAAGATAATTCAACCTGGGC AATCCTGCTTAATTATCAAATATGCTTTGAAGCTGTTCAAACAATCGGGA ATGTCTAATCCAATCTAGAAGCACTTAAAGAGGACAAAATAGGTTAAAAT GAAACCTTTTCGGGAGTTTCTCCCGATTCGGAACCATAGTTTTGCCTGTT CGAGAAGTTCCTCCCGATTTGGAAGAATCTTTTCGACTGAAGGACTCGTC CAATTGTGATTGTAAATAGTTTTGATTTGGAAAGTCTTGGAAATTATACC AGTACTTCAACACAGTTTGCACTTAGATCTTTGCTAAAACTAGATATGTT ACCTTGaattttaactttaattttctatttcgcGATACtttttcgatttg ttcttttatttttaccGGACCCGACTCACCCTAAAAATAAAgtgtatcca gatataattggcaatGGAAACAAGAAttcctgtaacttttgattgtcaaa tataattgtgaaatttttttttgcttcttttagagaatcaaaagtgctat atttgaatgtatttttagttgaaaaattcgcgatttttagttgaaaaatt cgcgattgtaaaaattgagcttctacttatgctacaacgttcatttttaG TAGTTTTCTCTTTCCCATTACGAATTAGTGCTTCTAGGATGCTTTAATTT GTGACATTTGACAAAAGGACACTTGTACTTTTCGAGGAGCTTGACCCGTA TAACGTTAGACTAGTATAGtcgttgaatgaaaaaaattacaccGGAAAAT TTTACTAGAGTGGTAAAATCGGGAAACCGTATCTAGAACGAtattgatat tctcaaatttcaaagttattttcCTTCTCTCTCGCGCGCTAATTCTCGTG TGAACGTTTTTCCGATTATACCTAGCCAGTATCCGATTTTGTTGCGCGCG GTAAATAACAGACTTGTTTACAAGTCTAGTATAACGTGCATGTCTTTTTT AGTTGGTACTGTACACTAACTAAATTTTTTAGTTTATATGATCTTTAACA GTACTACACGTCATATTTTCAAGAGTTCGGATACGGTCGTGGCCTATACT ATAAAACGATAACCAGAAATTCTGAATTGAGTTATGGTTTTGATACCTTA AAAAGCTTATAGTGTAGAAGGGTCTCGACCCCCTTAACCCCATATTTATA TTTGTATAGTATATTTCTTCGATACTCGAAGAGCTGTGCattttttctga tagtggattgtttttataaagaaaagtgtctaatagcttttttatttttt ttcaagtctttATAATAGTGTTCATAGTTTCTCCTTATAGAATAAATATG TTTTCATTAtaccatttttattttgtccagttatgtcttatgtgtttcat tgtatCAATGgggtttcaatgttcattgattagtttttgatggcataccg gataagtgggatgggggaacctgggaacctaaagtgggaaactaaatgaa cacctgaaaagtgggactGGGGAACNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNatttaggttcccactttag gttcccaggttcccccatcccacttatccggtatgccgtttttgataacc aggtaggtccataaaagttttaaatgaaaatttccgGTATTCCGGAAAAC GTGATCTACTGCATTCAATTATCATCTTCTTGTTCTTCTCTTTAATTTTT TCAGGTGTAATACAACTAAAGAAACTTCGAAATGATTGCAGTATATTTCT GGTCCCAAAagctgtcaaaaatttgaccaaaacctTCTACAGGATGAGTG AGTTAATCCAGGCTATTTCTCTATTGGACTTTTGCNCGATCTACTGCATT CAATTATCATCTTcttgttcttctttttatatttttcaggtGTAATACAA CTAAAGAAACTTCGAAATGATTGCAGTGTATTTCTGGTCCCAAAagctgt caaaaatttgaccaaaacctTCTACAGGATGAGTGAGTTAATCCAGGCTA TTTCTCTATTGgacttttgcagaaaaaaatttaacccCCACTGTTGatag gatattgatttttcgtaTTGAACCACTTGGATATCCTTCTTTATTATTAA AGACCCCTTGATATCCAGTCTTAAAAGATATGCTCAACcgcctggatatc ctctcttataaagatgcttatcCCCTAGATATGGTTTTTACGGGGGgagg ggcacggactatttctggaaaagcccatttccaTCTCAACCAGTTAATTT TAGTTAAGGCTCGACTGCTCTTATTTTCTTTTCTCGCTATTAGCCTTTAC TTATTCACAAGTTAACTTATAGGATAGTATTGAGCTTTTTTGGGCCTCAT ACTCTATTTTTACTGATTTGACCCTAAGTTTGCGCAAAGTCAAGCAATTC AAGACTTGGGATTGTTCTTgaattgttctcataaaaaagatgTATAGCCA TTCCCCTGCCTCTCCAAGTTATCGGGTTTTGGCAATGTTAATTTTTGTTC CAGGATAAAAAGATATgtacatgcttttttttataagaatacactttata ggAATGtctatgatgaaaatggccaaaaaattttatGATGCTAAATATAT CACTATCATAGAACTTGGCtgctcaagctaagaatgccattttatgcaTG AGACGTATAttctaaatgttaaatctgaagtctgaattaggatcctaacc taagaatgctgtaagaatattttaggatgattatcccagttaagaatatc catgatgaaatggatttacaccaatcttataaaaaaaagcgtgtatcgtA AATAAATGTGTGTAGGTTAAAAACTTCGATATTCCTATATTTGAGGGGTT GTTTTTTTAGAAACTGGCTAAGCTTGTCTGGAATATCAACCACGCACTTA CACATTTTTTGTGTTCCATATGGATTTTTATTTCACCTTTGCTCTGAAAA AGACATTCTCCTTTTAAAAAATGAGGGATTTTAAAACCAGAAGGTTCCCA GTTccaatccccgctccttccaatgttctgtTCATTTCccagatagccga gccggctgacGTGGAAAACAATTGAGTCAAAGATTATTTGGGCTATCTGc aatcagcgccgaaatatattgggaattttgggtattttaacgtttttcag aatttaaaggtcgggcgggaattgcagtttcagtagttccactttgcttc attggatttttcgatttgagaggggttaagtggcttccaggctacattcc cagccttattggaacattttttagcttttagatcctgagatacTAAGGTC CTAGGACTTAAGTCTTATGCTGAAACTCTATCTTCCAAACTGTACTTCAa taagcacttaaaaatcacttgcggttttaaagtttggagggaattcccct tttgtgccaaatatttcgagCAAGATTGTAGATTACTTGGATATCTTTTG TGTTTTTCAGTTATCTATGGATTAGGAGTGCTGGTGGCATTTACGTTACT GGTGTTCATCATGTATTACGAATTCAATATGAGAGAGGAATGGGAGAAGA AGCATTCCAAGTATATCAGGTAGGTAGCTAATTATTGATGACATTGTTGc aaccttttcgaccgtagtcgcgcggtcggGCGCGTGTCACACGATttttt aattatccccctaaactcgatccaatccttttttgacacatttttctatt gcctataggtgcgaaaaaaggactgagacggttttagtgggataaagcgg acaaaaaaatgcccgcgcggcaattggtggctaaggtcgaaaaggtgtat aaacACCGGGTGTGTTTATGTATTCGTTCCCTGGTAAACATTAATTGTCT GATCAgctaaaacaaaaacatgatCCTCACTAATCGCaagtgattttcca aaattatttttctctttagAAAGGGAATCAATGTCTTCTGATAGCTCTTG AATATCTGATTTCATAGAATAACATTCTACTGTGATACTTCGTTCAATGG CAATAAGAAAtgcaaaaacataaattttccATAGGACTAACATATTGTTA CTGGtacttaaggcttggggacacgagaagtttttttcgcgttggtgcaa tgcaatatGCTCCATctcaccaacctgaaacgctttctcgtgtctccacc ccatttttctttctaccaataaaagtgagaTCGACAACATAAcatttaat aacatttgtgtgtctctcacttttgtccctgggacacttgcattgcacca acgcgaaaaaacttcgcgtgtccccaagcctttactcAAACAAATCATAT ATAAACAATTGGAAACACATAATTTAATTGCTTTCAGTACTCGTAGATTA AGCTTTCAAGGAAGAAAATTTGCAGATGAAGCTTTTGTTTATCATTTTAA GAGACCGCAAGAAGCACaattataactttttaaaaacacaGTTTCCTTGT GAATGTTCACAAGATTTGAGAATCTTCTCCAATAATCAATTCGTGATAGA GACTGTAAACCCCTCACAACTGGAAAAGGGAGTAGAATGGCTAAATTTTG TGTGTTGGTTTACAGTTTTCTGAAGGTAACCATCCGGGGTTATGTTTGCG AGAAGACGGGTCCGAaccaaaaaatcgaaaatcgacccttagagagagga AGAATTACCGTTTTGGGACACTTAAAGAgacttttctcaaaacttttttc aattttagctcgatttttatccaaattttggaaaatcacgaTCCTctgag agaaaaaattttgaatttcgtgaTTTCGGAACCTTACacgatttttttat aatgtttttttgtacccctttgagagatttTCGAGggtggctcgcacata cccggcaacCATATCGCTAATGCCAAGCCACCAAGCTTACCCTAGTCTTC ATATTGAGAAAAATAGAATATTCCTGAGATTCTCTGAGCTGATATATTGA CTCTCATCGTTATGACGAAAACAATGATTATTTTTCACACTACTTTTAGG TGCAGACTTGAAACTGTAAGCCTTCCAACATCTCTTTCCAAAGAATGTAT TCCGCCTGACAAATCAAGATTGCTTTGTCTTCATTGCTATATTTTGTTGT TACTCCTCATGTCACTTCTTACGAGCTCGTGGACATGGACATTTGGAACA CTAAAGATCTGGAAGAAAGCTTGGAAAAGGTGAGTGATGCTGATTTTGAT TTTACACTTATTCGTATAAACCCTCTTGCCTGTTTtcttactgttttttt tttgccttaacTCTCTAATACTTCAAACCAACCCCCCTGCTGTGCTTATA ATTGGACATTTTTCAAGCGAATCAGAGGTTTGTTAGTTAGAAATTCCACC CGTTAAAAGCGTAAAAATGTTTTGGAAAACTTTTAGagaagaaaatcttt tgtttgaaTTCTGTCTGAGACTTCTTGAAATCTCAATTTTCTATTAGACA TTTGGAAACAGATAAAGCTAAAGAACGTTTGCAATTTCAAAGGGCGTGGT ACCGACGTATTAACAGCAAGAAAATACAGTGAGTTTTTTTCCTGTTTACT TTACTCTGATTTCTACGGAACTAGAAGGAGTTAACGAATTTTGTATATTG ATGTTATGATATGCTGTTTTTGGGGTGGAAAAAGGAAAATTGTGTCGAAT TTCGTGGTCTTCGGACTCTTTTGGCCACCCCAGAAATAAAGTTGACTCTC TGATTACATCTTCAAGGAACCAAAAattaattcgaattacagagagtaga CCAATGctttagttcgaattaaagaaagatttgagtaacagagattcgaa ttagagagagctgaCTGTATTGTCAGTTTAGCGCTGTTGGACAAAATTCA ACAAACAAAAACGACtcgattttttacttttaggcCGTTTCTACCACCAA TCAACCCTCAAAACCCATTGgaggaaaacaaaatcaaattcaTGCAACCT GACAAAAGGCTTTCGTTGCCCGACAATTTATTCGTCTCCACTCACCAAGG TGATAAAAAGAACCGACGACATTCCGACGACATTCGATCAGTTGTCGAAC TATTTTCCATACGTCGAAACACCATGTGTAGCCTGAATTCCGTCATCTCG AACGAGGTCAGTCTAAAGCCAGTTCATTCTATACAATCTTTTGGGCATCT GTCGATCGCTCATAATATACCCTCAAACAGAGGCGCTCCCACAAATCTAA CAGTCATTCAAGTCTATCAAAACCCGACAAATACCGACGAACTACAACGT CAGTTTCTAAATAAACCACAAACGACGAATTTGACGAGTGACGAAATTCG GCATATACGAGACAGGCTTTATACACCACTGACAACTGCACACAAAGATA GCATAATAGCGGACTGTTTACCGTACAACCGGACGGACTTAGAGCCGGAC TTAATCTCAAGTGCAGTTGAATTGAGACAAAGTGTTAGAAATCATGAATT TTATAACTCGATTGAATTGATTGAGTCATTAAGTATCCATAGTACGAAAA TTTGAGATAGTGCACCCCTGTATAGAATTGTAATATGAAGATATCTAATC CACAGATCCAGAACTATACTCCGAACTTACTCAATAGATTAACAATTTCG CTACAGAGGACCTGGTCAATGCAGTAGCTTCAGGCGGGGGAGGGGGTATT TAACTCCCTTTTTAGAAAGTGATCTGTTTCTAAAACTGACTATTTTCGTT TCTCTTTATCTGAACAAATTCTTTGAGTTTTTAGTTCTAAG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000028XLOC_000028Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000047-exon-sc0000001-1491911889:1118042..1118065TCONS_00000047-exon-sc0000001-1491911889:1118042..1118065Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1118042..1118065TCONS_00000047-exon-sc0000001-1510915933:1118042..1118065Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1118042..1118065TCONS_00000047-exon-sc0000001-1575043694:1118042..1118065Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1118408..1118627TCONS_00000047-exon-sc0000001-1491911889:1118408..1118627Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1118408..1118627TCONS_00000047-exon-sc0000001-1510915933:1118408..1118627Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1118408..1118627TCONS_00000047-exon-sc0000001-1575043694:1118408..1118627Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1138291..1138420TCONS_00000047-exon-sc0000001-1491911889:1138291..1138420Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1138291..1138420TCONS_00000047-exon-sc0000001-1510915933:1138291..1138420Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1138291..1138420TCONS_00000047-exon-sc0000001-1575043694:1138291..1138420Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1149346..1149438TCONS_00000047-exon-sc0000001-1491911889:1149346..1149438Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1149346..1149438TCONS_00000047-exon-sc0000001-1510915933:1149346..1149438Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1149346..1149438TCONS_00000047-exon-sc0000001-1575043694:1149346..1149438Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1151102..1151210TCONS_00000047-exon-sc0000001-1491911889:1151102..1151210Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1151102..1151210TCONS_00000047-exon-sc0000001-1510915933:1151102..1151210Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1151102..1151210TCONS_00000047-exon-sc0000001-1575043694:1151102..1151210Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1152641..1152820TCONS_00000047-exon-sc0000001-1491911889:1152641..1152820Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1152641..1152820TCONS_00000047-exon-sc0000001-1510915933:1152641..1152820Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1152641..1152820TCONS_00000047-exon-sc0000001-1575043694:1152641..1152820Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1153089..1153169TCONS_00000047-exon-sc0000001-1491911889:1153089..1153169Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1153089..1153169TCONS_00000047-exon-sc0000001-1510915933:1153089..1153169Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1153089..1153169TCONS_00000047-exon-sc0000001-1575043694:1153089..1153169Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1491911889:1153525..1154382TCONS_00000047-exon-sc0000001-1491911889:1153525..1154382Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1510915933:1153525..1154382TCONS_00000047-exon-sc0000001-1510915933:1153525..1154382Clytia hemisphaericaexon
TCONS_00000047-exon-sc0000001-1575043694:1153525..1154382TCONS_00000047-exon-sc0000001-1575043694:1153525..1154382Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1118042..1154382 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0.0385662 0 0 0 3.63869e-09 0 0 0 0 0 0 3.95756e-09 0 0.0217034 1.36028e-08 0
Blast
BLAST of TCONS_00000047 vs. Swiss-Prot (Human)
Match: SMO (Smoothened homolog OS=Homo sapiens GN=SMO PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 2.074e-25
Identity = 56/198 (28.28%), Postives = 103/198 (52.02%), Query Frame = 2
Query:   44 CILSFILIYFSGLSTSCWFVILNYSWYISFRTMGSIKTLIQSKIKYFHFFAWGISGSFTLMALLLQAVSAHPITNICFIHLSHNQQHLHDGLVAFPFTVCLVVGEFLLLKCVIQLKKLRNDCSIFLVPKAVKNLTKTFYRMIIYGLGVLVAFTLLVF-IMYYEFNMREEWEKKHSKYIRCRLE-TVSLPTSLSKECIP 631
            C++ F+++Y++ ++   WFV+L Y+W+ SF+ +G+    +  K  YFH   W +    T+  L +  V    ++ ICF+   +       G V  P  + L+VG + L++ V+ L  ++++    L  KA   + +T  R+ I+G  +   F L+ F   +Y+F  + EWE+    Y+ C+   T+ LPT   K+ IP
Sbjct:  314 CVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFV--GYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGF-LAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPT---KQPIP 505          
The following BLAST results are available for this feature:
BLAST of TCONS_00000047 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SMO2.074e-2528.28Smoothened homolog OS=Homo sapiens GN=SMO PE=1 SV=... [more]
back to top