Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000043 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000043
Unique NameTCONS_00000043
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1026

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000043 ID=TCONS_00000043|Name=TCONS_00000043|organism=Clytia hemisphaerica|type=transcript|length=1026bp
CGACCAATGTCAACCAATCACTGACAAtTCCACCCAAAATCCTTAGCATC
ATCAACACAACTGAAGTCACCCAGGGCGATAGTATTATCTTACAATGTAA
AACCCAGGGCAGTCCTGAACCAATCACAGTTTGGACATTTGGAGAGAATT
TCACCACCATCGCAATAGGATACGGAAGATCCAAGATGTTACCAGGAGGC
GATCTGATGATCACTGAAGCTCAAATGCAAGACACTGGCAAGTACACGTG
CATCTCTGGCAACGTTGGAGGTACAGACACAGCCTCTGGTTATCTCTTGG
TCAATGACGTTGATGAATGTGTGACGGGCAAACATAATTGCTCACATCTC
TGTACAAACACCTATGGTGGTTTCGAATGCTTTTGTTATCAAGGCTACAC
CTTATTGGCTGATCAAAGCACGTGCCAAGATGTGAACGAATGTGAGATGT
TCAATGATTGTGATCACTTCTGTTGGAACACTGAGGGAAGTTACACGTGT
GGCTGTCGTCATGGTTACCAGCTGCAAGAAGATAACAAAATATGTAAAGG
CAACgaagaactaataaacaaaaCAATACCTGTTCACCATGGCAACCATA
CCTTGACAACCAGAAACAACATTCATCCGCACATGCGCAGTGGGAGAACA
ACACGTCGTGTTTTACATCTAATCACTATCATAACACTTGTGGTGACGTT
GATTCTTGTCTCGCTTGCCTTGTACTTAATGTGGAGAAATTATAAGAAAA
GATGGAGGATGAAAGAGGCAACATCGAATATGAATGAACCACCGgtCAGA
TCAAGATGTTCAGCAatgttttcttggaaataattttctagtttgttttc
ttttgtaaattgtaaaaaaataatagtGATTTTTAGTGTATATAATTTTG
TAATTAAAGATTTGTTACTTTTgttgtaaattattttgaagttcGTATAC
TTTCATAATACTTCTTTTTTTGCCTTTTGTACATACAtacttttgaaatc
aaaattgtaaatataCTGTAATTCTT
Run BLAST on NCBI

transcript from alignment at sc0000001:1071776..1076558+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000043 ID=TCONS_00000043|Name=TCONS_00000043|organism=Clytia hemisphaerica|type=transcript|length=4783bp|location=Sequence derived from alignment at sc0000001:1071776..1076558+ (Clytia hemisphaerica)
CGACCAATGTCAACCAATCACTGACAAGTAAACGAATTGCTGATTCGATT CTTTTCCTTATCATACATGATTGATTTAACgtctttatttttacttttaa atttttgaagtcttcggattttcttgactttttgagttttaagccctaaa atgttcttataacatgttcttattttcaccattttggaagtttttttgtc aattttcctcaGAAATTATGTGTTTTAGAGTGCATAAAGTTTTAAAACGT TCCCAGCTTGTTATTGATATTTTTCCACCAAAGCCAATGTTCTcgtatag tttgctcttataaaaaacgtgtattttcaaTCATATTCTATCTGTTTTAC ATCAAAATCATTTATTCGACTGCTTCATaaacttcaattttctttccttt tagtTCCACCCAAAATCCTTAGCATCATCAACACAACTGAAGTCACCCAG GGCGATAGTATTATCTTACAATGTAAAACCCAGGGCAGTCCTGAACCAAT CACAGTTTGGACATTTGGAGAGAATTTCACCACCATCGCAATAGGATACG GAAGATCCAAGATGTTACCAGGAGGCGATCTGATGATCACTGAAGCTCAA ATGCAAGACACTGGTAAggttttttgttctttttttactttttcttattt tagttCAGCATTAAAAAAAGGAGGCTATTTTAGCGTTTAACGGTTAATCG GCTGGATGGTATTCtattttgaatgataaatttaaCTTTAATAATTAGTA TTTACTCGGATATATTGATAGTTaaagaattgaaattattttttcaacaa tGACAGTTTCATGTCCTATTCAAACAATTTCAGTAAAAATAAAACTCGCA TGTTGATTATTACTGggataaaaattttgaacttcGTCGCTATTCAATTA cacctttcttttctttttaatgctttctgatttttttttaattaataccG TGTGATGACTATTTCAATTTCCTTCCCAGGCAAGTACACGTGCATCTCTG GCAACGTTGGAGGTACAGACACAGCCTCTGGTTATCTCTTGGTCAATGAC GTTGATGAATGTGTGACGGGCAAACATAATTGCTCACATCTCTGTACAAA CACCTATGGTGGTTTCGAATGCTTTTGTTATCAAGGCTACACCTTATTGG CTGATCAAAGCACGTGCCAAGGTATATCAAATTCTAATTGGTTCAATGTT TAATATTTTGACTTCTAACATAACACGGTAAATGGTGGAATTGCGAATCT GAAGATTTTCGCGTTGGTTAAAGTTCGCGAGTCAGcgtctttttcaaaaa tttttcgagaTCACTAAAGTgccaaaaatttgcgaaaatcgcgaaagttt aaGCGTAAAAAATACTGAGAATCAATGATTATTTTGAGGGTAAAAGGCGG ATTCTTATTGTTCAAACACACTCCTTTAATGAGCCTGGTGATTATATACA AAGTAATTCTTACCAATAAATTTTTCTCTCGGTTTTTCGTAGATGTGAAC GAATGTGAGATGTTCAATGATTGTGATCACTTCTGTTGGAACACTGAGGG AAGTTACACGTGTGGCTGTCGTCATGGTTACCAGCTGCAAGAAGATAACA AAATATGTAAAGGTAAACTACGGCTGCTTGATTGTCTACAGTGTGTGAAC GAACAAATTTTTATGTAAAGCTAAATCATCACATTTCATTATCTAAATTC ccgggggggcagctgggcaaaaggatcgacgggtatgtgcgggtcctaag ggtaccttttccaatatgtttaaaatgcactgtaagggtcggaaaaacta gagaNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNCCCCCCCCCGGGTCTAAATTGGGCTTAGAATGATTA AAATAAGATTAAAATTTTCTGCTCAAacaatagatattcaattccaaaga cgattgaataggtttttgagATTAAAATAATCAAGTATGAaagtcatgaa atttggcataaattatgaggattttttTGGGACCTGCTGTTTATCTAGAT CAGAGTGTTTCAATTACATGGCCAGCTTTTTTTCGGTAGAGACATCTTCC GTAAACACCTTCCAAAATGATCATTGGGCCTCAGCTAAAAACAGTGGTTT TAGATTCCACACCaatggaaatctttttttgagTTAACCAAAAAGGTCTT GtgaattctttattttattctgtATTACTTGAGCCATTTAAGTCTCCCTG TTTTGAGCAAGGGTTGAAATAAGCTACCAGTTTCTTCTAAGTCTGAGAAA AAGTTCAAACCTTTTACGATAACCTACTTCTTTACTcattttaaattctt tctcgTAGACATTGATGAATGTACCATGGGAAGTCATCAATGTGAACATA ACTGCACTAACACCCAGGGCTCATATTTTTGTTCGTGTAACCCAGGGTTC AATTTGTCATCAATTGATCACGTGACCTGTAAACGTCGTAAGTCATTCGT TTGATATTTGACAGAATATAGCTTTAGAAAGTTTATATGAATCAGAATCC AAGTCTCATTAAAATACATTGCAGTGCTGTGCAGTGCAAAGTTTTCCCTG TCAGACGGAacttgaaatgcaaaaaaaaacaaatatttacATTCGCCCAG AATCTtcgattttgcaaaaaatttagACGAAAAGACCTCTTGTTATAGCT TACTGACACGTAGATgctaacaaaatatttttattgtctTGGGATTACCA AAGATCTTCGGAAAAGGGGAGCATATCTTTATCGACTAAGAGCCTAGAAC CTTGGCTATGAAGGACGCAACAACTTTAAGCATAGATTTTGGACCCTCGC CGTTTATTTGAACCAAGTTGTCCGTCAATGTGAAACCCTCGCGAAACACT TATATGTAATATTCCAATTTGAGTCATCGAGAGCTAACCGTAAGCATCTT TTTTGTTACTAGGCAACgaagaactaataaacaaaaCAATACCTGTTCAC CATGGCAACCATACCTTGACAACCAGAAACAACATTCATCCGCACATGCG CAGTGGGAGAACAACACGTCGTGTTTTACATCTAATCACTATCATAACAC TTGTGGTGACGTTGATTCTTGTCTCGCTTGCCTTGTACTTAATGTGGAGA AATTATAAGAAAAGATGGAGGATGAAAGAGGCAACATCGAATATGAATGA ACCACCGGTAAGGATACTCTCTTGTTCGTTCATAAAAATATAGACTATTC CACATAAACCGGCACTACTGACATTTTGAGGAGATCTTGATTTCTGTCAA ATGAGTTCTCTGGAAAATCAAAGGGGGTTTGTAAATAGTCCACTGGGTCT TTTAAAATTAGCCAGAACCCAAAGGAGGTTTTTGAATCTTGATCAAAGAA TCTGATTTGGAAATAAAAAGTGCTTTAGCCTCCAGAATATGACCGCCTTG GCTTTATTGGTTTCTTTGcggaaaagattttaaaatattttttcaggaaa agccaAACTTTTTGGAATGAAAACATAGGAtaggaaaaatcaattttttg gtgtttttgcctTAAAATCTTAATCATGTtacatttcatttattttttca ggtCAGATCAAGATGTTCAGCAatgttttcttggaaataattttctagtt tgttttcttttgtaaattgtaaaaaaataatagtGATTTTTAGTGTATAT AATTTTGTAATTAAAGATTTGTTACTTTTgttgtaaattattttgaagtt cGTATACTTTCATAATACTTCTTTTTTTGCCTTTTGTACATACAtacttt tgaaatcaaaattgtaaatataCTGTAATTCTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000027XLOC_000027Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000043-exon-sc0000001-1491911889:1071776..1071802TCONS_00000043-exon-sc0000001-1491911889:1071776..1071802Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1510915933:1071776..1071802TCONS_00000043-exon-sc0000001-1510915933:1071776..1071802Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1575043694:1071776..1071802TCONS_00000043-exon-sc0000001-1575043694:1071776..1071802Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1491911889:1072179..1072388TCONS_00000043-exon-sc0000001-1491911889:1072179..1072388Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1510915933:1072179..1072388TCONS_00000043-exon-sc0000001-1510915933:1072179..1072388Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1575043694:1072179..1072388TCONS_00000043-exon-sc0000001-1575043694:1072179..1072388Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1491911889:1072755..1072946TCONS_00000043-exon-sc0000001-1491911889:1072755..1072946Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1510915933:1072755..1072946TCONS_00000043-exon-sc0000001-1510915933:1072755..1072946Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1575043694:1072755..1072946TCONS_00000043-exon-sc0000001-1575043694:1072755..1072946Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1491911889:1073268..1073387TCONS_00000043-exon-sc0000001-1491911889:1073268..1073387Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1510915933:1073268..1073387TCONS_00000043-exon-sc0000001-1510915933:1073268..1073387Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1575043694:1073268..1073387TCONS_00000043-exon-sc0000001-1575043694:1073268..1073387Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1491911889:1075688..1075932TCONS_00000043-exon-sc0000001-1491911889:1075688..1075932Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1510915933:1075688..1075932TCONS_00000043-exon-sc0000001-1510915933:1075688..1075932Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1575043694:1075688..1075932TCONS_00000043-exon-sc0000001-1575043694:1075688..1075932Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1491911889:1076327..1076558TCONS_00000043-exon-sc0000001-1491911889:1076327..1076558Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1510915933:1076327..1076558TCONS_00000043-exon-sc0000001-1510915933:1076327..1076558Clytia hemisphaericaexon
TCONS_00000043-exon-sc0000001-1575043694:1076327..1076558TCONS_00000043-exon-sc0000001-1575043694:1076327..1076558Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1071776..1076558 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0.0491673 0.0962051 0.0302098 0.296556 0 5.96423e-05 1.4637 1.3062e-07 0 3.05693e-08 2.03293 0.96558 0 0 0 0.396399 0 0 0 0 0 0 4.69281e-10 5.4448 0 0 0 0
Blast
BLAST of TCONS_00000043 vs. Swiss-Prot (Human)
Match: SCUB1 (Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens GN=SCUBE1 PE=1 SV=3)

HSP 1 Score: 83.1889 bits (204), Expect = 2.188e-17
Identity = 36/73 (49.32%), Postives = 45/73 (61.64%), Query Frame = 3
Query:  306 DVDECVTGKHNCSHLCTNTYGGFECFCYQGYTLLADQSTCQDVNECEMFNDCDHFCWNTEGSYTCGCRHGYQL 524
            D++EC+     C H C NT G FEC C +GY LL D+ TCQD++EC     CDH C N+ GS+ C C  GY L
Sbjct:  282 DINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHRGYIL 354          

HSP 2 Score: 78.5666 bits (192), Expect = 7.320e-16
Identity = 55/140 (39.29%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  192 PGGDLMITEAQMQDTGKYTCISGNVGGT----DTASG--------YLLVND----VDECVTGKHNCSHLCTNTYGGFECFCYQGYTLLADQSTCQDVNECEMFND-CDHFCWNTEGSYTCGCRHGYQLQEDNKICKGNEE 560
            PG DL    AQ Q     TC  GN G      DT +G        Y L +D    ++ C      C   C +T  G  C C  G+TL  D  TC+D+NEC + N  CDHFC NT GS+ CGCR GY+L  D + C+  +E
Sbjct:  191 PGFDL----AQNQKDCTLTCNYGNGGCQHSCEDTDTGPTCGCHQKYALHSDGRTCIETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDE 326          
The following BLAST results are available for this feature:
BLAST of TCONS_00000043 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SCUB12.188e-1749.32Signal peptide, CUB and EGF-like domain-containing... [more]
back to top