Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000041 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000041
Unique NameTCONS_00000041
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length5437

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000041 ID=TCONS_00000041|Name=TCONS_00000041|organism=Clytia hemisphaerica|type=transcript|length=5437bp
aaaaagaaaagctttGAGTTATGCtgaagtcaaaattttgtagaaaattC
GACCAAGGAGATAGGTCAGAGTTTAAAAATTCAGAAAGCTTGGTAACCTG
AAACatgtgattttttgtttttatgtacTAAATGTAAAGGGCTTATACCT
TAAGTACCTTATTAAAGATATTCCAATGACGTTTTAGTAACTGGATTAAT
AATTGCATCTTAGATTTCAGAAGAGTAGAGTTTGAGATATAATTATTACC
AAAGATATTGCATGACTATTTTATCACTGggtcttgaaaaagaaaaccca
TACTGGCCGTTACATATTTCTTGATGAAAAAACGATTCAAAAAGTGTGCT
GGGATTCAACCAAAGTGTGACCATTTATTTCATACTTGTGTTGTTGCTAT
GGTTACTTGAAGcaaCAAGTGGATCATTGATTCACTACGGGTTCGAGCAA
CATGAACTAAACAATGTGGCAGATGATAGTGGCAATCATATCAATGCTTT
GTTAATGAATGGAGCACGTGTGACCAAGCAAGACGCAAAATGTGGCGCTG
CCCTTGATTTAAACGGTGGAGAGCTTATTATCCGTGGTCAAACTCTATCA
AATAGAGGTATTGATGCCATAACTATAGCCATGTGGGTGAAAGTAAGAAA
CGAGAAAAGAGATTTATCGCTTTTTAACGTAGACAGTAAGACCTTGGATG
GCTCAGGTGCTGTTTTGGCACtcgaaattaaagatggtagacTACATTGG
AGCCACGTGGATGAGACAGGGGAAGTTGTTTTTCATTTGGAGACTGTACA
GAAATCGACTATGCCTGTAGGGCTTTGGTCACACGTGGCTGCTACTTATG
ACCCCGCAAAAGGCTTCGCAAGGTTGTATATAGATTCACAATTCATCAAA
GAAGTACAAGGGAATGGTAAAATGTCATCACAATTTAATGGGAAGATTTC
GATTGGTCGAGACGGTTCGTTACCAGGCCTCGTTGACGAGTTCTATTTCT
TTGAGAAAGCACTCTCATTCAACGATGTCAAAGATCTATCGGAGCTTTGT
AACGTTGGCGGTGATTATCCGATCCCGATGGAAAATGCTGCCGACTTGCA
ACGATTATCGACCGATAAAAACCGCAAAACGGAAGTCGGGAACCGACATT
CAAAAGTCGCTTTTCACGAAGATGACACCGACGCTACTCGGGATAATTGT
CGTAAGCAGATTGCATTCCATAATACCGACTTACGTGGCAGCGAAACGTC
CGGCNTAAAACAGAAGTCGGGAACCGACATTCAAAAGTCGCTTTTCACGA
AGATGACACCGACACTACTCGGGATAATTGTCGTAAGCAGATTGCATTTC
ATAATACCGACTTACGTGGCAGCGAAACGTCCGGCGTTTTTACCGACGTC
GGTGACGTGACGTCTTTAGACGAATGTGTCGAAAGATGCTGTGCGTCAAA
AGAATGTCATATAGCGTACATGAAGAAACGACGCTGTTTTACTGTCGTTT
GTCATTTTCCGTCGTTATGCCAACCGGTCAAAGTTGGCCGTTCATTGGTT
CATGTGGCGTTCGTGAATAGAAATGGTGAATCCGTTTACATTAAAGATGA
GACACCAAACCAATTAGACACATCAAATGAAAATGGAGGTGACGTCAGCC
TTATTCACCATCTTACCACAtcaaccaccaccaccaccaccagcaCTGCT
GCACCAACCAATCAGCTTCGACGTTGTTTGCAAAGTAACGTGTACTATGG
AGTGGCTTTGAAAGGAGGATGGACTTCTGGCAAATTCACTGATAAAGGTA
TTGTGCCAGATCTGAAAACATGTGTCAATCATTGTTGCAATGAACCGGAT
TGCGATTTAGTCATGCTGTTGAGACAGAAGTGTTTCACCATACACTGCTA
CAGTCTGGATGACTGCCAGACCACACCCAATGGCCACGCCCATATCGCAT
ATGTGGCTAGAGATGGCTACCATTTAAATCCGACCACAAGACCACCAACA
CATACTCGCCCAAAACCACGTATCTCAACTGAAGAACCTCACTCAGCGAA
TGGACCAACACGAAACGGACCACCAGTAAGCAACCACGCAAAGTATCCAA
GCATGAGCGGAAAGAGGCCTGATATGGTCCTGCATtacacttttgaaaaa
cttgatgAAGATCTGGTTATTGATGAATCGAGTTTTAACAACAATGGGAA
ATTACTTGAAGGTGCCAGCGTTTCACCAGCCGGCGGTATCCGTGGTAACG
GTGTCTCATTCTTCGGTGGTGCAATCCTATTGGATAGTCAGACGTTCAAA
CCCAAACCTCTTAAAGCCATTACTGTTGCATTATGGGTTAAACTACAAGA
CGTGGCAGGACGGAATACGTTGTTTGCAACGATGGGACAGAACGAACGAA
ACGGGTTCCGTCTAACCGTCATTGAGGGGAAGATTAGTTGGCTTTACGTT
ATTGACGGACATGAAAAATCGTTCCAGCTACGTACAGGACCTATATTAAC
ACGTAATAAGTGGTTTCAGATTACAGCCACGGCTGATGGAGACGTCGGGG
AAGCAAAGGTTTACGTCAACGGTGGCATACAATCAATAGGTGTCACACGC
GGTCAATTTTCAACCGATTGGGGCGTGAAGGCGGGATTCGGAGTACATGA
GGGCGGCCATCCTTTACATGGAATCATGGACGATGTGTATATATTCTCAT
CAGCTTTATCTAAAGACGAAGTGTTAAACTACATCAAGAAATTCGATGAA
ATGCGTTTCCTAATGACTCCGGCACCTGTGACCGTCCCCGTGACTAGACG
ACCGACGCCAACGAGCCGAAAAATGACAATCAAGATCAAGACGTTCAAAC
CGTCTACAACAACGACGACTACAACAACTCCACCGACCACCACAACGACC
AGTACAACAACAACTACGATACAACCAACAACATTCACAACACTGAGCAC
CAAAACAGTCACAAAACCATTATCTTTACAACAAAACAGATGCAAGTTCG
GTAACGTTTACGAATACACAGACCTCAAAGGAGGACTCGGTGCTGGTAAT
TTCCTAGATCGTGGCATCACACCAAACGTACAAGTTTGTATGGAGCTCTG
TTGCGCACACACTACTTGCGATCTTGCGTATGTGGTGTCTTCTAGATGTT
ACTTGGTGGAATGTTATACAACAGAGTTGTGCTCGGTTGTTCCCAAAGGA
CTTGGGTCAGTTTCGCCTGTCATTGGTATGATCATAAGACCAGATGGTCC
GAAAATTCCACAACTGGGCGACAATGTTGTTCTACCACCAACACGCCCAT
GGACCACCAACGAACCAGGCGTTACACCCGACTCTTTGAAAAACATGAAA
GACCTCAAATTGGCGTTAGAAGATACATTAAACCCATTCAAACATAAAAA
GAAGACACCAAAGaaatgtattttcaaaaagacattGTCCAAAACTACCT
TCGTGGGTGGTTTAAAAGCAGGGAATTTCACCAATAAAGGCACTGTGACG
TCAATGAGTGTCTGTAAAGCAATGTGTTGTCAGTCTGACAGATGTGACGT
AGCAGTGATGATGAAGAACGGTTGTTTCTTATTGACATGCAAGAGTGCGG
AACTTTGCAAGCCAAGAAAGGCGCAAACAGAAAGTTTCACATTGAAATTG
GCATATCGAGACAAGGTTAAAGAAATGGAGGCAATCGAGACAGAGGAGGA
TAATGACGAAGATGACGAAACGGAAGATGAAGATTCTCACACGTCATCAA
CGTCCACTGCACTTCCACTAAATCCTAAGATATCACCAACACTGCCCGTC
CCAGTTCTCTTACAAGAGTCCTTAACCGACAATGGAAAACTACAGAAACC
TATCAGTGATACCATACCCCCGGTTTTACGACCACAAAACGGGGTAACTT
CATGGTGTTCTCCATCATTCATATTGGCCGGTGTTGAATTGAACGGGGGT
ATTCAATCGGGACCATCCAAAATTCTTGGTAATGTCTCTACAATACAAGA
ATGTGTTAGCGAATGTTGTCGTGTTCCCGATTGTACTGTTGCGTATACGG
AAGGCAAGACGTGTTACGCTGTACTGTGTTTGAATCAAAATATATGTCAA
GCGCGCATTTCGACGCCGTCAAAAAGCCTCGGTTACGTCGTTAGAAACGG
TTGGTCGCTTTTCCCGTCAGAACAAAACGCCTTTAAAGGAGCTGCTTTCC
TAAACACTCAACGGCCTGAAATCATCCCAGATACGACCCTACAaacaacg
acaacgaccactTCTACTCCAACAACTACAACAAGTACCGTGACAACGAC
CCTTGCAACGACCAACTTAGCAACCACACCCCTAACAACGACAACAGAAA
TACCTAAAAACGTCAGTATTGACATTTCCTCAATAACGCCAGAATCAact
gtcaataaaactgaaacATGCCGCTCTAACGGAACTCTAACCGACCACCG
TTTCGTTGCCGGAATGAAAGCCGGCATTTTTACCGACCACGGTGAACTTT
CTGATGTCGATGATATACCGTCGTGTGTCAAATACTGCTGTCTAGATAAA
CTGTGCGACGTCGCTTACATGGTCGGGAGACGTTGCTACACACTTCAATG
CTTTAGTCGTCAAACGTGCCAGACGTTTCCTGCTCCAAATTTCTTTCTAA
ACCCGGTCATTGCATTCGTGGTCCGAACGAAGCCACCAAAAGTTGACATC
ATCAGTGTTGATTTCATTAAACATAACTATACTGTACCACtaacaaattc
aacttttagAAATTCTAGTATGACAGACAAACCCAGCATTAATGTTAAAT
TGAGTAAGAAAACAATGGACAATTCAAATCAGCCGTCAAAAGAAAATGAC
GAATTCGTTGAAGATCAAGTTGAATCAGGATCAGGTTCCGGAATAGACAG
TCCTGGTTTTACACGTGGAAACGTACCAGATGCGGTATTGGACCAGTTCG
AGAAAACGCAAGAACGATTGCCACAACCGACAGAAAGATACTATTTCCCT
CTGAGCGATGTGGATTCAAATGTGATCAAATCATTGAGTGATGATAAAGA
TTTCACTGAGTGTAGTTCAACAAAATACggttgtgagcatttttgtatCA
CCCTCCTACACGGAGGTCCAAGATGTATGTGTAGGAACGGTTATCAGCTA
GCATTGGACGGCCAACATTGTCTCTACGAAGGAGAGTGTGAACCAAAAGC
ACATGGTTGTGATCAGGCGTGTAAATTTGTGACTGATGGCTTTCAATGCC
AGTGCAGAAGTGGTTACGTATTGAAGAAGACGGCATATAAAAGCTCATGC
CAAGATTTAGACGAGTGTGCAATGGACATGCATAGTTGTAGTCATGGTTG
TTTAAACACACCTGGTAGTTATGTTTGTCAGTGTCCTGGTGGTTACCAAT
TGGGTACAGATCGGTTGACTTGTCAGCTTATCATCGG
Run BLAST on NCBI

transcript from alignment at sc0000001:1056169..1070141+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000041 ID=TCONS_00000041|Name=TCONS_00000041|organism=Clytia hemisphaerica|type=transcript|length=13973bp|location=Sequence derived from alignment at sc0000001:1056169..1070141+ (Clytia hemisphaerica)
aaaaagaaaagctttGAGTTATGCtgaagtcaaaattttgtagaaaattC GACCAAGGAGATAGGTCAGAGTTTAAAAATTCAGAAAGCTTGGTAACCTG AAACatgtgattttttgtttttatgtacTAAATGTAAAGGGCTTATACCT TAAGTACCTTATTAAAGATATTCCAATGACGTTTTAGTAACTGGATTAAT AATTGCATCTTAGATTTCAGAAGAGTAGAGTTTGAGATATAATTATTACC AAAGATATTGCATGACTATTTTATCACTGggtcttgaaaaagaaaaccca TACTGGCCGTTACATATTTCTTGATGAAAAAACGATTCAAAAAGTGTGCT GGGATTCAACCAAAGTGTGACCATTTATTTCATACTTGTGTTGTTGCTAT GGTTACTTGAAGGTAAGTACGATTTGAGAGTAGGGTTAAGTTTGCGGATG TACTAGGTTTTGAGTCGAAACTTTAACTATNAATTTGAGAGTCGGGTTAA GTTTGCGGATGTACTAGGTTTTGAGTCGAAACTTTAACTATAATTTTCCA AGATTCTTCGAGGATATTTAATGATGAAAAGCCTACAAAATCATGAATAA AAGACTAGAATAGGCatctaaattttctttcaagagtGTCTAAAATTGTA TACATTTTCACTGTGAAAAGATTGATCGGCGTCTCAGAATGGTAGATGGA GATGTGTAAAGTCCCAGCCAATTCCATAAATATAGTGTATGAAGGAGGTA TATGTGGGACGTAGTGGGACGCTCTAGAGTGttccacttgagcgtcccac tatCGTCCCACTTAGCGTCCCATCGTCCCACGTCCCTGCAAAAtctatga gggagtgcagacgtttatgacatattcattatcttttgatacaacaaaga caataattacagtgtcgtaaaaaccgctcccGTCCATAcatttgcagggt atctcgctacgcctatgatcgtcccacgtcccacttatCCAGTATGCAAA ATATAGTTTATGAAGGAGGTCTCCCCCCATCAATTCCTGTCTTTATTGTG TAGGTTTTAAGTGACAAAGAGAGTACTCCGTTCAAACCAGTTTTAGCAGG GAACCTTTTAAAAGTTCTTTTGTAATTACCAAGATAGCATAACATTGTAA GAAACCGATTCAATCTGTTTGTTACCGTGTTGTGCTCATCTTGAAATTAC aaggtgaaaaattttttggaaccaatatacgttttttatataagaacata caaaatttttgaagccttcggatatttataactttttgagttttaagcct aaaaatgcctTATTTTCGCCATGTGAGTATATTTTTGGTCCGATTtcctt aagaaattgggtgttttagagtccgcaaagccttaagggctctgaccata gtccaaaaattaattttggtatttgaacataaaagttatatttcaggttc cttaacacttttaacaaagaattgcNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaaatgacgttatgaact ttaaaaagatgttaataatatgttgcatcaccctcttttacaaaaagtgc ttagttttaatgggtaattaaattttttgtttcaaaattcctttacactg tctgcaaagaattgaactattttaaattttgcggaaaatttttctaaaaa gatgtgtcaaaagttatgtcgttttttttaagcaaaatccagatgaaaaa ttgatgaaaaaccactattttgaagatttcgagacaaagaagcatttaca aaaattttccgcaaaaatttttattgttcggtaaaagatacaccatgtac tgcgaaaaaattttcaaaatgttttttcttcgccgaaactaagctcttca aagttgaaatactcttcctcgcaaaagtcttcattttcttcttcatcaaa ttttttcaatgcaatttttgaattttcagattcaggaatagtttgtctaa cagaaaatgtataacatgccatagttttgttggttacatcagtcagaaaa cacattttaaacacggcaattatgaaaaattcactatggtcagagccctt aaaataatcttaacttgttctcatatagtttgttcttacaaaagaaaacg tgtaagttttttttctacactTGTGAGATATAATGAATTGAAGATTTTTA TAGAAAGCATAACATTGTAAGAAGCCTTTCACCGGCTTTTTACGCTGTTA CGCTTTCTGGGAGACTCTTGCTAACGAAAAAGGTCTCCAAAACCTGGCAT AATTGAACTTTTTCTATCTTTGAAAAATAAGGTTTGAGATTTTTCTAGAA AGCATAACATTGTAAGAAGCCTTTCACCGGCTTTTTACGCTGTTACGCTT TCTTGAATTTTCTTGCTTATCAACAAAACTTTATTGGAAATAGTTTGAAT TGTATCGTTGATAGGAAACATGTAAGTGTTGCCGTGGAAATATTGACATT TTTTGTAACATGTAGAACAGTACATCTCTATCGACCCTGATTATACTGGT CTTCAAGTAGCACTTCTTCACCAATGAGTTAAAGAAAGTATTAGCTCAGT CAACATGGAAATCCATTCCTTTCACATTTTTGTATCATTTCGGTCCACAC ATTACTGCTCAATTCTATTCcgaaacaaagaaaagacattCTAATGGATG GTTAGAATCGACGAAAAACTTTTAGCCAATATCTTTACTTAGTTTCAGCG TAGAAGATGGAGTGAAATACGTGAGCGTGGCCTCTATCAAACAAGATGTA ATAGTTACCGGACAGATGCGAGAAAATCCGGAACAAGTagaatatttcca tatttcgagcaaatgtctgataactggtttatcagtaatccaaaaaatgc actttttgtgtagGAAAAAAGCGCagatacaagatatattgtactctttt taacggTTGGCGTGAAAACATTAGCTATTTCTTTCACTCAATACTTTGAA CAACTTTTCAATCCATCTcatctttcttttcaatttttaatattttagca aCAAGTGGATCATTGATTCACTACGGGTTCGAGCAACATGAACTAAACAA TGTGGCAGATGATAGTGGCAATCATATCAATGCTTTGTTAATGAATGGAG CACGTGTGACCAAGCAAGACGCAAAATGTGGCGCTGCCCTTGATTTAAAC GGTGGAGAGCTTATTATCCGTGGTCAAACTCTATCAAATAGAGGTATTGA TGCCATAACTATAGCCATGTGGGTGAAAGTAAGAAACGAGAAAAGAGATT TATCGCTTTTTAACGTAGACAGTAAGACCTTGGATGGCTCAGGTGCTGTT TTGGCACtcgaaattaaagatggtagacTACATTGGAGCCACGTGGATGA GACAGGGGAAGTTGTTTTTCATTTGGAGACTGTACAGAAATCGACTATGC CTGTAGGGCTTTGGTCACACGTGGCTGCTACTTATGACCCCGCAAAAGGC TTCGCAAGGTTGTATATAGATTCACAATTCATCAAAGAAGTACAAGGGAA TGGTAAAATGTCATCACAATTTAATGGGAAGATTTCGATTGGTCGAGACG GTTCGTTACCAGGCCTCNGTAAAATGTCATCACAATTCAATGGGAAGATT TCGATTGGTCGAGACGGTTCGTTACCAGGCCTCGTTGACGAGTTCTATTT CTTTGAGAAAGCACTCTCATTCAACGATGTCAAAGATCTATCGGAGCTTT GTAACGTTGGCGGTGATTATCCGATCCCGATGGAAAATGCTGCCGACTTG CAACGATTATCGACCGATAAAAACCGCAAAACGGAAGTCGGGAACCGACA TTCAAAAGTCGCTTTTCACGAAGATGACACCGACGCTACTCGGGATAATT GTCGTAAGCAGATTGCATTCCATAATACCGACTTACGTGGCAGCGAAACG TCCGGCNTAAAACAGAAGTCGGGAACCGACATTCAAAAGTCGCTTTTCAC GAAGATGACACCGACACTACTCGGGATAATTGTCGTAAGCAGATTGCATT TCATAATACCGACTTACGTGGCAGCGAAACGTCCGGCGTTTTTACCGACG TCGGTGACGTGACGTCTTTAGACGAATGTGTCGAAAGATGCTGTGCGTCA AAAGAATGTCATATAGCGTACATGAAGAAACGACGCTGTTTTACTGTCGT TTGTCATTTTCCGTCGTTATGCCAACCGGTCAAAGTTGGCCGTTCATTGG TTCATGTGGCGTTCGTGAATAGAAATGGTGAATCCGTTTACATTAAAGGT ACCCTGTAATTTAAATAAATACCATATTTGTCttcaaaggtttcaaaaaa acaacagttgactctctctaattcgattttcaagggaacaAGAATTTTCG TCGAATAAGAAGTACGGAGGGTTTTTTTATGCGACTTTCAAGCTGAGCGG ACCAATGTTTTAActtgaattacagagagattcgaataaggAAAATTAGG ATCAGAGAGAGAGTTGcctatatttcaaatttttagagcaCGGTCTGGAG AGTTTAACCATCGCCGGTGCGATTCTTTTAAGACAATTACAAATACACCA ATATCAACACTGCACTTATAAAGCACAAGCTTCATGTGATGATTGACGTC TAACATCTATAATAATGAGATAGCCATATGATATTTTTTCGACCGTGGTC TAAACACAAACTAAAGAAAAGGGAAGAGAATTCAGACCTATGTTAAAAAG AGAATAAGAACATATCTTTAAGTTCCCACGTCATCTCCGTTAGCAATTAA GATATTAACATAAAAGTTTCTAGCGGCCCTTGTCGCACAAACACATTCAA CTATCAATTTTCAATACCTTTTCAGATGAGACACCAAACCAATTAGACAC ATCAAATGAAAATGGAGGTGACGTCAGCCTTATTCACCATCTTACCACAt caaccaccaccaccaccaccagcaCTGCTGCACCAACCAATCAGCTTCGA CGTTGTTTGCAAAGTAACGTGTACTATGGAGTGGCTTTGAAAGGAGGATG GACTTCTGGCAAATTCACTGATAAAGGTAATTTCTTTGTTCGTTTTGATA GTTAAAGGCTAAAGGCTACCTTACCTTTCGAATTCATAAAGACACCCCCT tcccacagacccactgggaacccttcccacagacccactgggaacccttt ccactggaaaaattgtccagtatatcgtccccggtggaaaattatcctct catttttgtccccacttaaaataaacaaataaaccaatcctcactgtaaa CTATGATGCTTTTCTCCCATCCCCGCTGGATTTTCtgtcttgaaaacaaa agaattgaaatccccgttcataaaaaatatcgaaatacaaatccccatcg agtttcactccgtaatttttatccccactggctgaaaaaatcctccCGGG TCTGTGAGGAGGAGGTGTATAAAGAAGTAAAACTAGCTTTATTGAATAAC AGAGACACATTGGATAAAgagaaaataatcttttttagGTATCGTGAAAA CATGTATCAATTATTGTTGTGATGAGCAAGATTGTGATTTAGTCAATTTC TTTGTGGATATTTGCTTTAGGGTTGATACGTGTAAGAAATAACAAAACCT TGCGACGACAGGAACAAACTAccatattttctttatttttccatgTAGGT ATTGTGCCAGATCTGAAAACATGTGTCAATCATTGTTGCAATGAACCGGA TTGCGATTTAGTCATGCTGTTGAGACAGAAGTGTTTCACCATACACTGCT ACAGTCTGGATGACTGCCAGACCACACCCAATGGCCACGCCCATATCGCA TATGTGGCTAGAGATGGCTACCATTTAAGTAAGTCCTCATTCTTTTATCC CTTTAAGAACTGACTGTTTTGTAAAAGAAAAAGGGTGATATGACTATCTC AACTTTTATTCAAAGATGAGACTCTTTTGGATATAAATGGAACCTTATGA AAATAATCATCAAATGATAagtgaagaaaatcaacttgaaagcaaaatct ttttgaatttcCTCAGGATGTTCTAAATCAAATTCTTCTTGCAAATGTTA ATTACGACCTTGGAACTTAAAAGTTTTGACTGGTGTAGCATTTGTAGGAA ATTTCTTCATGGCAGAGATTGGAAAAGCTAGATTTGATTGCACATTGTAT GTTTTCTCGGTCATATTattcaaatctaaaattttcaatacaATTAATCA GATCCGACCACAAGACCACCAACACATACTCGCCCAAAACCACGTATCTC AACTGAAGAACCTCACTCAGCGAATGGACCAACACGAAACGGACCACCAG TAAGCAACCACGCAAAGTATCCAAGCATGAGCGGAAAGAGGCCTGATATG GTCCTGCATtacacttttgaaaaacttgatgAAGATCTGGTTATTGATGA ATCGAGTTTTAACAACAATGGGAAATTACTTGAAGGTAAATACATATTCA CGAGATTCAATCTGCCAACATTTCCCAGACATAACAATTTTAACAGCTAT GAGTCGAAGGGgcgaatttttcaaattgattcAAAGTTACgctcaaatga ataaaaagtgCTCAGGTGAAAAACTGCTAAAAGAATCACACCAAtaaaaa ttgatccaaattttcaaaaacattttcattgtattttcagGTGCCAGCGT TTCACCAGCCGGCGGTATCCGTGGTAACGGTGTCTCATTCTTCGGTGGTG CAATCCTATTGGATAGTCAGACGTTCAAACCCAAACCTCTTAAAGCCATT ACTGTTGCATTATGGGTTAAACTACAAGACGTGGCAGGACGGAATACGTT GTTTGCAACGATGGGACAGAACGAACGAAACGGGTTCCGTCTAACCGTCA TTGAGGGGAAGATTAGTTGGCTTTACGTTATTGACGGACATGAAAAATCG TTCCAGCTACGTACAGGACCTATATTAACACGTAATAAGTGGTTTCAGAT TACAGCCACGGCTGATGGAGACGTCGGGGAAGCAAAGGTTTACGTCAACG GTGGCATACAATCAATAGGTGTCACACGCGGTCAATTTTCAACCGATTGG GGCGTGAAGGCGGGATTCGGAGTACATGAGGGCGGCCATCCTTTACATGG AATCATGGACGATGTGTATATATTCTCATCAGCTTTATCTAAAGACGAAG TGTTAAACTACATCAAGAAATTCGATGAAATGCGTTTCCTAATGACTCCG GCACCTGTGACCGTCCCCGTGACTAGACGACCGACGCCAACGAGCCGAAA AATGACAATCAAGATCAAGACGTTCAAACCGTCTACAACAACGACGACTA CAACAACTCCACCGACCACCACAACGACCAGTACAACAACAACTACGATA CAACCAACAACATTCACAACACTGAGCACCAAAACAGTCACAAAACCATT ATCTTTACAACAAAACAGATGCAAGTTCGGTAACGTTTACGAATACACAG ACCTCAAAGGAGGACTCGGTGCTGGTAATTTCCTAGATCGTGGCATCACA CCAAACGTACAAGTTTGTATGGAGCTCTGTTGCGCACACACTACTTGCGA TCTTGCGTATGTGGTGTCTTCTAGATGTTACTTGGTGGAATGTTATACAA CAGAGTTGTGCTCGGTTGTTCCCAAAGGACTTGGGTCAGTTTCGCCTGTC ATTGGTATGATCATAAGACCAGATGGTCCGAAAAGTAAGGAACgcatttt ttcatttgtttaggactaaaggcttggggacacaaaaagttttttttcgt gttggtgcaatgcaacatgtaCCATTCCACCAACACAacacgctttctcg tgtctccaccccatttttctttctaccaataaaagtgaaatctcactttt gtccttgggacaatggagcaaaattgattcgaagtGTGTAACACATAAGA AGTGCAATTTCTCCCAACTTGGTAGAAACTGACAACTGAAACTTACCATT CTAGGCTCGCAATAATTTCTTGCGAAAGTAATtcaattttgccaattttc aggTAAATTTTTTAGTACACTATTACTAAGTAAAACTCAAACCACTCCTC TTTCCATAGTTCCACAACTGGGCGACAATGTTGTTCTACCACCAACACGC CCATGGACCACCAACGAACCAGGCGTTACACCCGACTCTTTGAAAAACAT GAAAGACCTCAAATTGGCGTTAGAAGATACATTAAACCCATTCAAACATA AAAAGAAGACACCAAAGaaatgtattttcaaaaagacattGTCCAAAACT ACCTTCGTGGGTGGTTTAAAAGCAGGGAATTTCACCAATAAAGGCACTGT GACGTCAATGAGTGTCTGTAAAGCAATGTGTTGTCAGTCTGACAGATGTG ACGTAGCAGTGATGATGAAGAACGGTTGTTTCTTATTGACATGCAAGAGT GCGGAACTTTGCAAGCCAAGAAAGGCGCAAACAGAAAGTTTCACATTGAA ATTGGCATATCGAGACAAGGTTAAAGAAATGGAGGCAATCGAGACAGAGG AGGATAATGACGAAGGTATATTACTAATCTTTAAGCGAAATAATCATTTA AAAGTGCCTGTCAAAGCTTTCATTTTTCTATTCTATTTGCCCATACACGT ATTTCGAAGACTCATCAGAAAGGCTCGGACAAAAGCGAACATTGAATGCT GTTGTCATTAGAATGATTAAAACACTGAATGttgagttaaaactctacat tTTATTCTAAATTATTGACTTGGGAGTGTCTCTGAGGCGTAAAAACATCC AAAGTGAAAGAGATTGTTCAAATCAAAAGGTTTAAAATGTTGAATAGGCT TGAATAGGCGCGCTAATAATAAGCAACATGTAACTAAGGATCTCAGGAAA GCTATTATGCTCCGTTCCCAACTTAAACGCACTGCTAATAAAACAAAGAA TCCTGAGGATGTTGCTCGTTATAATCGTCAGAGAAACTTTGTTGTTAATA AAAATAGGAAAGCTAAGAAATCTTTCTTCCTCAAAAATGACCCAAAACAA TCTCCCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAGTAC Ttgtaactattttttttttattaccaacgttaaataaagaacaaataaat aaaataaatttttgatgttttcgCGCACTGTTAACGGGGGCTTCTTTTGA TGTTGCGCGCACTGTTACAGGGGTATTTGATGCTTTCTCGCACTATTACG GGGGCTTCTTTTGATGTTGCGCGTACTGTTACGGGGGTATTTGATGCTTT CGTGCACTGTTACGGGGGCTTCTTTTTATGGTGCACGCTTCTTTTGAggc ttcttttgaaaatacGTAATGGGTAAAACAGCTTTGATTCATTTTCATCC ACAATTTCTTCCCTTTTACCTCAGATGACGAAACGGAAGATGAAGATTCT CACACGTCATCAACGTCCACTGCACTTCCACTAAATCCTAAGATATCACC AACACTGCCCGTCCCAGTTCTCTTACAAGAGTCCTTAACCGACAATGGAA AACTACAGAAACCTATCAGTGATACCATACCCCCGGTTTTACGACCACAA AACGGGGTAACTTCATGGTGTTCTCCATCATTCATATTGGCCGGTGTTGA ATTGAACGGGGGTATTCAATCGGGACCATCCAAAATTCTTGGTAATGTCT CTACAATACAAGAATGTGTTAGCGAATGTTGTCGTGTTCCCGATTGTACT GTTGCGTATACGGAAGGCAAGACGTGTTACGCTGTACTGTGTTTGAATCA AAATATATGTCAAGCGCGCATTTCGACGCCGTCAAAAAGCCTCGGTTACG TCGTTAGAAACGGTTGGTCGCTTTTCCCGTCAGAACAAAACGCCTTTAAA GGAGCTGCTTTCCTAAACACTCAACGGCCTGAAATCATCCCAGATACGAC CCTACAaacaacgacaacgaccactTCTACTCCAACAACTACAACAAGTA CCGTGACAACGACCCTTGCAACGACCAACTTAGCAACCACACCCCTAACA ACGACAACAGAAATACCTAAAAACGTCAGTATTGACATTTCCTCAATAAC GCCAGAATCAactgtcaataaaactgaaacATGCCGCTCTAACGGAACTC TAACCGACCACCGTTTCGTTGCCGGAATGAAAGCCGGCATTTTTACCGAC CACGGTGAACTTTCTGATGTCGATGATATACCGTCGTGTGTCAAATACTG CTGTCTAGATAAACTGTGCGACGTCGCTTACATGGTCGGGAGACGTTGCT ACACACTTCAATGCTTTAGTCGTCAAACGTGCCAGACGTTTCCTGCTCCA AATTTCTTTCTAAACCCGGTCATTGCATTCGTGGTCCGAACGAAGCCACC AAAAGTTGACATCATCAGTGTTGATTTCATTAAACATAACTATACTGTAC CACtaacaaattcaacttttagAAATTCTAGTATGACAGACAAACCCAGC ATTAATGTTAAATTGAGTAAGAAAACAATGGACAATTCAAATCAGCCGTC AAAAGAAAATGACGAATTCGTTGAAGATCAAGTTGAATCAGGATCAGGTT CCGGAATAGACAGTCCTGGTTTTACACGTGGAAACGTACCAGATGCGGTA TTGGACCAGTTCGAGAAAACGCAAGAACGATTGCCACAACCGACAGAAAG ATACTATTTCCCTCTGAGCGATGTGGATTCAAATGTGATCAAATCATTGA GTGATGATAAAGGTATGGTCtgatatttcttttgtttcattgACTACGGT AgactctccctaattcgaacttctattattcaaacCTTCTAGGTATAATC CTAACTAGTACTTAGTCCCTGTCAAGgaaaaaaaacagtaaaaattacTT TCTTTATTTCGAATTATCGAGAGTGAACTGTATAATATCTCGATACCTTG GAACAATAACTTTTGGTAATATAATTGTTTAAAGTAACAGATTTTGGCTT GGCTACTATTAccatacaaaagaaaaatatggttTTCATCTTTCGCCCGC CACATCAAACTCAATAACAATTACTTTCCCTAAATTTTCCTTCGCAGATT TCACTGAGTGTAGTTCAACAAAATACggttgtgagcatttttgtatCACC CTCCTACACGGAGGTCCAAGATGTATGTGTAGGAACGGTTATCAGCTAGC ATTGGACGGCCAACATTGTCTCTACGAAGGAGAGTGTGAACCAAAAGCAC ATGGTTGTGATCAGGCGTGTAAATTTGTGACTGATGGCTTTCAATGCCAG TGCAGAAGTGGTTACGTATTGAAGAAGACGGCATATAAAAGCTCATGCCA AGGTGAGAAATGAAGACTTCAATTTTATAGAAAATTAAGACTTTTTAAGC CCGTGTTTAAAAATAGTCATTGTTAggctttaaagggacataacagtact tgtgaaatttgtaaacaaactgtatgcagcggatacaaaatcaaaacaaa tgtcacatgtcaaaataaaaaaccaaaccaaatatggctaattttaattg ttcaattgttttacaagtttgttttggactcgtgattttaattgttctat ttaatgacacgtggttcgcgcaatgtttacattttacttctttaatgtcc ctttaaaatgaATTAACGTACAGAGAAACTTATTAAAGTGTActtcattt taaaaagaacCAGTGTTACCAGACTATAGCCAAGTCTAATTATTCTTTGA ATTGCTGAGTTTTTACGTTCAATAATATGAACCAAATTATGGaacgaatt tttacaaaaatttacctCCTTTCATTGCTTCCTCTGATAGATTTAGACGA GTGTGCAATGGACATGCATAGTTGTAGTCATGGTTGTTTAAACACACCTG GTAGTTATGTTTGTCAGTGTCCTGGTGGTTACCAATTGGGTACAGATCGG TTGACTTGTCAGCTTATCATCGG
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000026XLOC_000026Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000041-exon-sc0000001-1491911889:1056169..1056580TCONS_00000041-exon-sc0000001-1491911889:1056169..1056580Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1056169..1056580TCONS_00000041-exon-sc0000001-1510915933:1056169..1056580Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1056169..1056580TCONS_00000041-exon-sc0000001-1575043694:1056169..1056580Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1059367..1059930TCONS_00000041-exon-sc0000001-1491911889:1059367..1059930Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1059367..1059930TCONS_00000041-exon-sc0000001-1510915933:1059367..1059930Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1059367..1059930TCONS_00000041-exon-sc0000001-1575043694:1059367..1059930Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1059997..1060616TCONS_00000041-exon-sc0000001-1491911889:1059997..1060616Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1059997..1060616TCONS_00000041-exon-sc0000001-1510915933:1059997..1060616Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1059997..1060616TCONS_00000041-exon-sc0000001-1575043694:1059997..1060616Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1061194..1061394TCONS_00000041-exon-sc0000001-1491911889:1061194..1061394Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1061194..1061394TCONS_00000041-exon-sc0000001-1510915933:1061194..1061394Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1061194..1061394TCONS_00000041-exon-sc0000001-1575043694:1061194..1061394Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1062017..1062196TCONS_00000041-exon-sc0000001-1491911889:1062017..1062196Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1062017..1062196TCONS_00000041-exon-sc0000001-1510915933:1062017..1062196Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1062017..1062196TCONS_00000041-exon-sc0000001-1575043694:1062017..1062196Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1062570..1062803TCONS_00000041-exon-sc0000001-1491911889:1062570..1062803Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1062570..1062803TCONS_00000041-exon-sc0000001-1510915933:1062570..1062803Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1062570..1062803TCONS_00000041-exon-sc0000001-1575043694:1062570..1062803Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1063009..1064052TCONS_00000041-exon-sc0000001-1491911889:1063009..1064052Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1063009..1064052TCONS_00000041-exon-sc0000001-1510915933:1063009..1064052Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1063009..1064052TCONS_00000041-exon-sc0000001-1575043694:1063009..1064052Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1064428..1064883TCONS_00000041-exon-sc0000001-1491911889:1064428..1064883Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1064428..1064883TCONS_00000041-exon-sc0000001-1510915933:1064428..1064883Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1064428..1064883TCONS_00000041-exon-sc0000001-1575043694:1064428..1064883Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1067593..1068930TCONS_00000041-exon-sc0000001-1491911889:1067593..1068930Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1067593..1068930TCONS_00000041-exon-sc0000001-1510915933:1067593..1068930Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1067593..1068930TCONS_00000041-exon-sc0000001-1575043694:1067593..1068930Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1069266..1069520TCONS_00000041-exon-sc0000001-1491911889:1069266..1069520Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1069266..1069520TCONS_00000041-exon-sc0000001-1510915933:1069266..1069520Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1069266..1069520TCONS_00000041-exon-sc0000001-1575043694:1069266..1069520Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1491911889:1070009..1070141TCONS_00000041-exon-sc0000001-1491911889:1070009..1070141Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1510915933:1070009..1070141TCONS_00000041-exon-sc0000001-1510915933:1070009..1070141Clytia hemisphaericaexon
TCONS_00000041-exon-sc0000001-1575043694:1070009..1070141TCONS_00000041-exon-sc0000001-1575043694:1070009..1070141Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1056169..1070141 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0 3.08986 3.71917 0.86796 1.07511 1.39137 1.06707 3.07382 3.03715 2.12655 6.54583 1.56926 2.80505 0 0 2.4542 2.91448 1.62576 2.26666 1.84311 6.09058 0.313852 0.171782 0 0
Blast
BLAST of TCONS_00000041 vs. Swiss-Prot (Human)
Match: MATN2 (Matrilin-2 OS=Homo sapiens GN=MATN2 PE=1 SV=4)

HSP 1 Score: 92.8189 bits (229), Expect = 1.172e-18
Identity = 50/124 (40.32%), Postives = 66/124 (53.23%), Query Frame = 3
Query: 5061 CSSTKYGCEHFCITLLHGGPRCMCRNGYQLALDGQHCLYEGECEPKAHGCDQACKFVTDGFQCQCRSGYVLKKTAYKSSCQDLDECAMDMHSCSHGCLNTPGSYVCQCPGGYQLGTDRLTCQLI 5432
            CS+ ++ C HFCI +  G   C C+ GY L  D   C  +  C  + H C+Q C  V   F CQC SGY L +   +  C  +D CA + H C H C+N  GSY+CQC  G+ L  D+ TC  I
Sbjct:  242 CSTLEHNCAHFCINI-PGSYVCRCKQGYILNSDQTTCRIQDLCAMEDHNCEQLCVNVPGSFVCQCYSGYALAEDGKR--CVAVDYCASENHGCEHECVNADGSYLCQCHEGFALNPDKKTCTKI 362          

HSP 2 Score: 86.2705 bits (212), Expect = 1.156e-16
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 5061 CSSTKYGCEHFCITLLHGGPRCMCRNGYQLALDGQHCLYEGECEPKAHGCDQACKFVTDGFQCQCRSGYVLKKTAYKSSCQDLDECAMDMHSCSHGCLNTPGSYVCQCPGGYQLGTDRLTCQLI 5432
            C+   + CE  C+ +  G   C C +GY LA DG+ C+    C  + HGC+  C      + CQC  G+ L     K +C  +D CA   H C H C+NT  SY C C  G+ L  D+ TC+ I
Sbjct:  283 CAMEDHNCEQLCVNV-PGSFVCQCYSGYALAEDGKRCVAVDYCASENHGCEHECVNADGSYLCQCHEGFALNPD--KKTCTKIDYCASSNHGCQHECVNTDDSYSCHCLKGFTLNPDKKTCRRI 403          
The following BLAST results are available for this feature:
BLAST of TCONS_00000041 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
MATN21.172e-1840.32Matrilin-2 OS=Homo sapiens GN=MATN2 PE=1 SV=4[more]
back to top