Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000037 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000037
Unique NameTCONS_00000037
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2026

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000037 ID=TCONS_00000037|Name=TCONS_00000037|organism=Clytia hemisphaerica|type=transcript|length=2026bp
CAAACGGTTGATAATTATTTTAGTGTCAATATCTCACATGTCCCTTTCAT
GTTTACTTGGTCGCATGCCTCCATATCAATTTTCTCTTCACTTTCAAACT
TCCCGTTAAACCGCCCCGCGTGCTGTTACGCCCTCTTTGACATGCTCAAA
CTATAGGCGGGATTTGAAGAGACTTGCTCAAactgaaaaaacaacaacaa
caaagatggccgCCAAGAGAAGTGAAAATTTTTGAGTGAAaactaaaata
ataatttttttgtatcaTATTATACAGTCATCAAACAGATAGAAGAGGTT
GAAAATTGACTATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCT
GCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGaTTGCTTG
TTGTTGTGGGTCTGCTGCTTGCAGTTTATGTTGTAAAGCATGTCCATCTT
GTCAAAATTCAACTGCTTCAAGGATTGGTTACACACTGGTACTCCTGCTT
GGATTTATTCTATCATGTGTCATGTTGTCACCAAACATCCGTCAGAAATT
GAATAAAGTACCTCACTTATGTCCAACATTTGATTGTGACCAGGTTGTTG
GTTATGTGGCGGTTTATCGTGTTTGCTTTGCAATGTTTGCTTTTTTCTTC
ATAATGGCTTTGATCACGTTTAAAATTCGTAACAGCAAAGATCCAAGAGC
TAGTATACACAATGGgttTTGGGCAATCAAACTACTCGTTTTCATTGCAC
TACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTTCTCTAGGGTTTGG
ATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATCCAATTGGT
TCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGGATTGGCAAGT
ATGAGGAAACTGACAACAAGATTTGGTTCATTGGACTGGCTGTATGTACT
GGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTGGTTTCATTTT
CTATACTAAGACTTCAGGATGTGGATTGAACAAattctttttgagtttca
actTCATCATTGCCGTTCTTCTGTCACTCATTTCCATTCATCCTCGTGTC
CAAGAATCACAACCAACGTCAGGGCTGCTTCAAGCGTCCATCATTTCTGC
ATACAGCATGTATTTGACATTGTCCGCCATGTCTAATGAACCTGGCACAG
ATTGCAATCCAGGTAGTTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGT
TTCGACACACAAACAGTGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGT
CTATTCGTGTGTGAGAACCAGTGCCAAAAGTTCTTCACTTTCCATCCAAT
CAGATGATGCAGACATCGAAGAAGTTTTGCTAATCGAAAATAATGGACAG
GGTGATGACGACGTGGAATACAAAGGACAAAAAGTTTACGATAACGAGAG
TACAGAAGTTGCATACAATtattcattctttcatttcactTATGCATTGG
CCTCACTCTATATCATGATGATGTTGACCAACTGGTACAGCCCTGAAGGT
GCAAACTTCAAAACCTTAACCAGCAGCATGGCTACAGTTTGGGTCAAGAT
GGCGTCAAGTTGGGCGTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGCGC
CTATGCTTTTTCCCGATCGAGAGTTCCACTAAAGTTCGCTTTCCAGTACA
AAAACCTTGTTTGTATATAAGTGTACTTTTGAATTTTGTATTTAGATCCT
TCTATTTAGGATCAATTCTGTAACTATttagtttatttgtttttggtAAA
GTTTAACCCATTGtataatttttagttttggtttcttttgtaAAATCTTT
GTTGTAAGatatattgttttgttttgtttaaaaagaaacttcCGATATGT
TCGATTAAGACCAGAATATACCTTTTCGTTTTTTTACATGGTAGCCAACT
CTTGCCAGGGACGGTTGGGATCACAGATTTCTGTGTCCAAAGGGCCAAGC
AAACGAACTTTATGCTGAATTGAACT
Run BLAST on NCBI

protein sequence of TCONS_00000037-protein

>TCONS_00000037-protein ID=TCONS_00000037-protein|Name=TCONS_00000037-protein|organism=Clytia hemisphaerica|type=polypeptide|length=456bp
MGSLLSLIGIGSAASCLPSIGGCAASQIACCCGSAACSLCCKACPSCQNS
TASRIGYTLVLLLGFILSCVMLSPNIRQKLNKVPHLCPTFDCDQVVGYVA
VYRVCFAMFAFFFIMALITFKIRNSKDPRASIHNGFWAIKLLVFIALLVG
AFYIPKGDFSRVWMYIGMIGGFLFILIQLVLLIDFAYSWSQKWIGKYEET
DNKIWFIGLAVCTGGLYAIALAITICGFIFYTKTSGCGLNKFFLSFNFII
AVLLSLISIHPRVQESQPTSGLLQASIISAYSMYLTLSAMSNEPGTDCNP
GSSFLQSDSFAPGFDTQTVLAAIFLFCTVVYSCVRTSAKSSSLSIQSDDA
DIEEVLLIENNGQGDDDVEYKGQKVYDNESTEVAYNYSFFHFTYALASLY
IMMMLTNWYSPEGANFKTLTSSMATVWVKMASSWACFVLFGWTLVAPMLF
PDREFH
Run BLAST on NCBI

transcript from alignment at sc0000001:1005161..1016571+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000037 ID=TCONS_00000037|Name=TCONS_00000037|organism=Clytia hemisphaerica|type=transcript|length=11411bp|location=Sequence derived from alignment at sc0000001:1005161..1016571+ (Clytia hemisphaerica)
CAAACGGTTGATAATTATTTTAGTGTCAATATCTCACATGTCCCTTTCAT GTTTACTTGGTCGCATGCCTCCATATCAATTTTCTCTTCACTTTCAAACT TCCCGTTAAACCGCCCCGCGTGCTGTTACGCCCTCTTTGACATGCTCAAA CTATAGGCGGGATTTGAAGAGACTTGCTCAAactgaaaaaacaacaacaa caaagatggccgCCAAGAGAAGTGAAAATTTTTGAGTGAAaactaaaata ataatttttttgtatcaTATTATACAGTCATCAAACAGATAGAAGAGGTT GAAAATTGACTATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCT GCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGGTTATAAT TGATAATTCTTTTCTTACTTGAAAATAATACAGTACAGAAGGGAGTAAAG AACACTTTgatttagttttttattttataatggctttaaaataaatttga attttcccAAATGGCGTTAGTGGCTTGTTTGCATAAGAAAATTCAAATGG TAAAATCAAACTCAACAGTGAAGTAGGTATTAAAGtgggaaagaaagaaa aaataaaaggcTAGATCTATTGCCAGACGGTAGGGTGTCTATCGAACAAA Tcaaacgccgaatcaatcgaacgcaatcgaatattacccaggatttactg ttcgattgcttcgattacgtttgattgtattcgattacgttcaattgatt caattttcaattcaagtattagattttatttgctttggtaTGGTACGCca acgctaaaaagctctaacagagtgatccaatttgataatcacaatcaaac tcatcgaacataatcgtaatcaaacattaatccaatgtaattgacaatca atcgaacaaatcgaacatagtcaactatcaatcgaacattactcgaacgc aatcgaacacaattgaatattacccaggaatcggccgttcgattaagata ttcgattacgttcgacaattgaatcgcaattattcgatatcgttcgatta tgttcgattggttcgattgaaatttttgttcgaagttgtacgattgacac cgtctggctattgcaaaaaattttatttttccaatagCTGCACCTTTCCc ataattcaaacttctcagaaatggcccgggaaaatgtgcactccaccgtt gtgtataaaattgtttgggaggtagtAAACGAACGTGTTTTTGCCTGCAA GGggaagggaaagtgggttttcgtgcagcttctaacttttgataacaatc ttcttttggcaaaagattttcagggtggtataatatcatgaatagattga gcATACCATAGCTGTCAACGGAgcgggagagctccaagtcggaaaaattt tctcgataatccaatttttccgaatcggaaaatcaggaaatcgaGGTAAT TTTCCTGCGAAATCcgattttatcagatttttttttccggAAATAGGGAA ATTTTACGCATGAATTTTCCAAATTCaggaaattttgccattccGCTCTT TCAAATTCTGAATTTTNCTTTTCCCGGAAATGGGGGAAATAGGGAAATTT TACGTCTCAATTTTCCAAATTCaggaaattttgccattccgctctttcaa attctgaatttttttcaagaaatcgGAAACAttttggaaatgcgggagat gcgggagaaaatcctgaaaatgcgggagatttggcTGATTTTTTTTCCCG CGGGAGAAAGCGCCGTTGGCATGCGGGAGTCTCCCGCCcaatgcgggaga gttgacagctatggcatactaaaatttgaggggattttgttcgacagatc ttaagaaaagctcaaaaaaccaattttccctaaggaaacgcaggcaaaaa cgggtttgtttacctccaaaGCCCAAATGCACAAGTGTTACGCATAAGCC AAATTGCGTaatacgaacaacctctaaattgccgagtacaagagaaaaaa aaatcgaaattcaaaatggcggctaAGCCCACCCTGATAACTACCGTgaa aggaccctgccgacgcactggacttaacgaacaccggacacgcaaaagtc tggtgtaaaaatgcagtccggtgcgtccggtgcttcttaattttttgttt tataaatgTCTGGCGTTCAAAATTCcatgtatgcaacaccggactgacac cagacttatttcgtccggtgtagcgaaaggatactttttgccaccggaca gtccggtgcgtcggcagggtcctaccGTGAATGGttctaaatccgacagc cctgcctaaatccgaccccccaaataaatatatgaaaaaaattctatgtt tacaaacattccctctccaagttgaacaataaactattgcaaggactctt gaaacaaaacatctgaTCTAAaaagatgactataatgtcaagatgtcaat caatgtgataaaaaaagtgtgagttgtaaaaataattacctctattattc tgaatccgttgcttgtgtttaaaacgttaacagtttatgtaataaaaaat tatgttttgtataagaaacaattattttaatttgatccaattggttcagt gtatcaaatctttcagtttagttgacactttggtatcttcattgtgtCAC AGCGAaccgaaaggtttgtttttattttagtttgtatctttgaaagaccc catcagatttaggcagggctgtcagatttaggaccactaacggtatcaaa aatcttcatttttcaatcagctacacaataaatcaatgaaataatttgaa ataaaaagtaaacaaaccttgaacctttcatgaatccaaatggATAAAAG tgttcatctaaagtgaagattacatttcaaaataaaacgatttccaaacc aacctaaagtcagtgtctgccaactaaaaattcctctgcggggtcactgg caaggagttacgacttcagactttatttagattccaattcttgtataggc tgcaactacactgccaaatgatctgtattacaaatacttccaaatgggtc cataagttaagaaaataaaattatcatctagcacgggggttttgtttata aaaacaaacttcaaaataaattttttaatgaacttgttacttaaaatatc actgactcccataatttatttatgatataacacccctttcttaaataaat ggcctcttaaagtattttatgtttgctGCAACGTGcaagaagagagaaaa atttaatttgatctttttctagctatttcccgcgtgttagtgtagacaca actttaatccggggaaatgaagcgttttcattagtctaaaatcacggatg gtcacgtgaccagaatttttatccagggaaatgctgtggcggcaatgttt tgctttagtgagattgaccgttttgttgttttgatttgagcgggcgaaat ttctgtacaaaccaaaatatggcttcgttggaataccgatTGAGACACTT TAGTTTGTATCTTCCAAAGACCCtatcggaattaggcagggctgtcagat ttagaACCACTCACGGTAATTTTTCAAGCGTAACAAGAATGATTTGAGCA GGGGGTCTGGTGGAATCCCCTTAGAAAATTTTGTCTGAAAAATGACCTTT AGAGATTGGCTAAACAGTTATGTTGATTCAAAATCTATTCCTCATTTTAT CAGATGCGATATCAAGTATTTATCTAAGCCTTCTagtcatcaaattttga tggGATAAACTAAAAAACTTAGCTCCTTATTACTATAGGAGAATTTTCCT AATTAGGTTTTCTTATTTAGATATTTCTCCAAAAAACTCTCTACATGTAA TAACCAGAAATGTCATCCTTGGGATATAACTCTTCAGGAAAATTTATATA AGTTTAATCATAAAAAGCATCAATTATATAGTATATCCCTCCCAAATTgt ttgttttactttattctacTACATATATCATATTTTTTGGGAGAAAacca atattttttaattttgtagaTTGCTTGTTGTTGTGGGTCTGCTGCTTGCA GTTTATGTTGTAAAGCATGTCCATCTTGTCAAAATTCAACTGCTTCAAGG ATTGGTTACACACTGGTACTCCTGCTTGGATTTATTCTATCATGTGTCAT GTTGTCACCAAACATCCGTCAGAAATTGAATAAAGTACCTCACTTATGTC CAACATTTGATTGTGACCAGGTTGTTGGTTATGTGGCGGTTTATCGTGTT TGCTTTGCAATGTTTGCTTTTTTCTTCATAATGGCTTTGATCACGTTTAA AATTCGTAACAGCAAAGATCCAAGAGCTAGTATACACAATGGGTAAGACG ATTAACTAACATATTTAGGATTGGATATTTTCTGTAATGAAAACGTGTCT TGTTTTATTGGCAACTAATCTGCCATGTTGTTTCCATTCACTTTTAGATT GACAGCCTTAGCATTTGAGTATTTAAACAATTCATTGAGAATCAACAGAA AACAACATTTGCAGAATTTACTTGTTTAGTTGTCAAAATTGGCTATACTT CCACAAGAACTTTACAATAGATTAGTCTATCAGAGCGTGTGTAGGAATTT TATTTGTATTATTCTATAAAATGGTAGAATAATTCCCCTGTTCTCAATAG CATAGCCAAGAGGGGCGtgaaatttgtgtaggagagcagattttatgcca ttataattatcttttaatactatgaatagataattacagtgtcattaaag tctgctctcctacacaaattttgcgcccctcttagCTATGCTACTGGTTC TTAATAATGGCTTTTTAGAACTGATAAAGGATCAGCATTCAACAAATAGA TAAATGTAAATCAACACATTGCATAATATTTTagattaaaagtttttttc ctaCTATGTTtcgttttttcaatttcaggttTTGGGCAATCAAACTACTC GTTTTCATTGCACTACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTT CTCTAGGGGTAAGAATCTTTTGTGAAGTTAACAACAAAGATATCATGGCA ATTACACCGATATTTTGAGTCTACACATACTTTTGTGCTTTTAACCTCTA ACCAGCGTCTCAACGAAGAAAATTTTGCTCCCTTttagatcgaattagag agagagagttaATCGTatcatttctttcttaaaaaattataaatgtaATA TACATATCTTTAAAACATTGTTTATTATGCAAGTTCAGTTTCCATTAGAA AAAGAATATATTAGAATGTTACAAGAACTTATTGTAAACTTATCCGGAGT TACATAAGTTTTCTACTTACTTTCATTATAAttgttaatttttaaaattc tagTTTGGATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATC CAATTGGTTCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGGTA TGtactcattgagtttaaagcccgaagggctagagttcaatctctaacct ttctcaggcaagaaaaagtgaagccttaaaaaatgcgccgcttttttgac gacagattgaatctagcaattcctttgtttacgattgatatttttacgaa atttagcggtaaattttagtttcaatctgtcatttgtgtaaaaaccaggc gagccgctcaaggccgcgcaactttggtaggatttgttggcttcaaatcc taccaaggagattgacttctagcccttcgggcttatacttcatggTATGT ACTCGTTCTCTCTTACCAACATAAAAATTGCACACGATCGCTATGGAGCC GAGCTGAACATTTGACCTTGTTTCGCTTGGATCTTATTGTTATCGAGACT ATTTTAATTGGACAAGTTTGCACTGCGATTAAATTTCGAGGTTGCGCTCT TCCGCAAAGATTCTAAGAATTTGCGGGAACTTGATTTCGCGGTTGGCACT ATAGGGAAATAATATTTTTACGATATTGTGCCTTTTTACCACAATTTATG CGTGTTTGTTGTCGAGATACGTATTACTAGCGCTTTTTTCATGCCAGTAA AGTATTAAATATAAAAGGCTTCAGAAGCTGAACTTTTGAATTTaccatga aaaaaatattgtgtTTCATTAAGGATTGGCAAGTATGAGGAAACTGACAA CAAGATTTGGTTCATTGGTACGTAATTTCATTTTATTGTTGAGCCTTTAA AAAAGTTGGATAAAGTATTTAAAAGTAGAAGCATATAACTATGCCATCAT GATTTAACAAGGTTTTGTTCGAATTTTCTTGAGATTAGCAATtatatttg tatattttttaaacatcCATCACTATCCGATTATGTACCGACTGTCTGAC TGTATTTTCCTTCCTGTGATGTATTGTAAAGGATAAACTCCGACGTCAAA TTAGAATTGTTACTATGTCGTCAAGAAATAAGCTTCGTGCTGAGGAAGTT TCCTTCCCGCAGTAATATGAAACTGAACTTGATTCattaaaagaatatat tttttggatACATAACGATCGGGTCAGAGAATATCTTCTTTTCAGGAGAA GCTTTAAGAATTCCacttttcactttcatttcGTTATTTTAGGACTGGCT GTATGTACTGGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTGG TTTCATTTTCTATACTAAGGTAGGAAGTTTatacttttctttaaaaacgT GGTCAGTTTTAACTTTGTACCTTTTTCGGCCCTTTTTAGGTCGGCCCATA TTTGCGGCAGTTAAAGGAAAAGGAGTCTTAGAACAACTCGTTGAGATGTC TCTCGAAacatacacacttttttaataTGAAACCCCAATTTTCAGCTCAG GGCTGAGGTtacttagcattctagctcattttctaaaagaattttctttg accacccctgatgTTATACAATACTTCTGCTTATTGGGCCAATGTGCTAT TGTTATAATTGAACATTCTCAGagtatctaaaaagcttttacttaaGAAG Atattaaaaaaggtttttttacccctgaaagaatgaaaaacacttcttta gaccccttttaccccctggaaatgttcttcCAACCCctatgtatggatat aaaatggaatgacccaTTAGGCGTCTtgctaacgtccatataatgttaAC TAACTCTTTTTACTCTCTATTCCCTCAGACTTCAGGATGTGGATTGAACA AattctttttgagtttcaactTCATCATTGCCGTTCTTCTGTCACTCATT TCCATTCATCCTCGTGTCCAAGAATCACAACCAACGTCAGGGCTGCTTCA AGCGTCCATCATTTCTGCATACAGCATGTATTTGACATTGTCCGCCATGT CTAATGAACCTGGCACAGATTGCAATCCAGGTAACAATTagttctagttt agacggcccacatttcgccctgcctattctaatggTGAATTAAGGTaagc ataaagtgggctgtctgaAGTCAATGCATtaccctcttttgacgtcaatg caatgtcttctttcaacctttttgAAACAAATAATTAAACTGCCCACTTT GTGCCCGCTTTGTGCCTACTCTTACAATTAGAATATGCAGGGCGAAAGTT GAGCCGTCAATACTAGAGCTTACCGCTGTTTAAAAACCTTTCCCGGTGTC ACGTGATGTATGCCCAATTCAAACAAGATTTATTTCTAGTTTAGTGCGAA AATGAGACGGTtgcgaaaatttcaaatttaaagtatTTTGTTTGACAGTA AAGTTTCTTGAACATAAAAACGAGGCATTGTGTAGAAAACGATCGAAAAT TTATGGAAAATAAAAGTGGAATATCTTTTGATCTAAGTAGACCAAATTAT ATAATTTCAAATCCCAGAGGGGGGTTGCACTCAATGTAAGCGACCTACTG TCGTCCGGCCCTTAAAAGAGAGAAAGTTGTACTGTAAGAtggaaaaatta ataaaatacgAAATCTTTGGGTGAAATTGGGGAAACTTCAAGAAAATTTA GCGGAGAATTTGAATAGCACTTTAAGGGCACgttttttgccaaatatttt ctttactGTAAGGGTCCAACAAAAGGTCAAAGGTCCTCCTCCCCGGGTTT CGAATGTCTCTCGAGTCGTCATTGTCGCCATGTTCACATATCATACATAG GCATTCGACGTCCTTCAACTCTGGTAAACTCGAATCCTTTCCCTTGTAAT GTTTCAAGGTCATGAAGTGGATTTTGTTCTACAGTTCGAGATTCTTTTTC TAGTGGCTTCCAACATCcttcaaattttatttaatgCCACCTTTAGCCGG GTGGTTATGTAATTATACTTTCTAGCATTTAAAAACGTTATACAAAATTT TGGTGTTAGGGTTTTATGTTACCCCGAGGGAAGATTTTCTCTGTGGTGTT AGCCTCGCTGTATTAAATGAGAACCAGTTTTTACTAATTCAAACTCTCTT TTCTACATGTGGTTTCTTCTTGCAAGTCATTCCCCTTCGCACCTGGTTTC GACACGAAAAACAGTGTTGGCAGCTATCTTTCTCTTTTCCCCGGCTTAAT CGTGTGTGACAACCAGTCCTTACTAATTCAAACTCCTTTTCTACAGGTAG TTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGTTTCGACACACAAACAG TGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTGTGAGA ACCAGTGCCAAAAGTTCTTCACTTTCCATCCAATCAGATGATGCAGACAT CGAAGAAGTTTTGCTAATCGAAAATAATGGACAGGGTGATGACGTAAGTT TAATAATTAAAGGAACAAAGTTCgggaatgggcttttccagaaaaaaaac cgtatTCCCCTGTTAAGGAAGTCCATCCCTGTGGCTggaaccccctggaa ttccagtcaatttcaggtttaaacccctctggaattctgaattttagtag gatttaaaaagctaccctacatggaattccagttatttttgacaaatttt tgtatctccctatggaattccgccacatatcaaaccttacccccttggaa cggaaatggacctgcTCAACagggtatacgttttttttctggaaaagtcc aattGCGTTTTATATTTTTAACCAACTGAATTAAAGTATCGCGAGTCTCG TTTTCAAAGTACCACGTATTGTTGCCAAGATATTTAACCGTCATTAAACA TGATTAATCTTTTTTGAGGGATTGTGATTTTGTAGCAGAATCTAGAATAT CTTTCGGAATACTTATCTAATAGTTGTCTAAATTACCGTAGCTACCTTTA ACAATCCAAAATTCCGCTTAACAATCGAATCACTTTCTATGCCACTGATT GGTTTGTTTGGCtcaatgaatttgaaatttgatcaatcaattgatttgat ttttgagctgacttttggattgttaaagGTATAAGCTACAGTAATTTAAC GACATTTACATATATATTCCGAAAGatattcttgagaaaaaattattatt ttccgGTTTTCCAGTCTTTTCTAGATTTTGTTCCCATTTAATTGTGTAAT GAATTTTAATATCatctttttatgttttcacGGATTGATTATATCAGTTT TTGAAAGGTTTAAACAGTAATTTGTTAGCCgtctttttttcatcattaCT CAGGATGTGGAATACAAAGGACAAAAAGTTTACGATAACGAGAGTACAGA AGTTGCATACAATTATTCANTATTACTCAGGACGTGGAATACAAAGGACA AAAAGTTTACGATAACGAGAGTACAGAAGTTGCATACAATtattcattct ttcatttcactTATGCATTGGCCTCACTCTATATCATGATGATGTTGACC AACTGGTACAGGTGAGTTTGACCACTCATTGAAACATTTTATTTAACTGG TCACTCTCAGCGTTAAGGCCAGTCTctacttgcgcgcgcttcgatcgcac tttttcgagcaaagcttccacactattagtcaaaagaaaaatgaagcaac tacATTGGTGCGATCTGGATCATTTCGAGCGCCcactacatttttatgac gttatcttttttccaagcaaaaaggattgaagccaaaaagtgcgattgaa gcgcgcgcaagtggagaccagtCTTTATAAAGAGAGGGTGGAAACATCAG ATGTCATTCTGCAAATTACTgaataaattttcgcgaatttccatgttaaa cattttcaaagacaCTAACTTTCACGAAAGAGGCCAAGACTGGTGGGATT CacgaaagttttcttttcgcTAAAATTTGCACTCTTAAAGTATTTGATCC TGTTAGATTAGGAATCCGTAAAGATTTTTGTGCTTTTTTTggacttaaag gttttgtttttaaataagggtGATATATGTAGTTTGCTTACTCGTTAGTT TCaacttacaagctttttcacacccctgtctcacagcctcggtggaacct ttttcctcaatggggataaaaatttcttttgaaattccaatggggataga aattcttttgttttaaggttaaataatccagtggggatggtttggagtgc aatttttaacattaaatttcgaatggggatgaaatgaaagtaaatttccc agtggggtaaTTTCCTAccggggaagaaatttttgccaaattttccagtg gggctggggtcccagcgggtctgtgacacaggggtgttttttcacattga ttattggtcagaaagaggaaaagaaaaatttcttgtttattcaatacaat ataacaatagggagagaccgtcctaatatgaaatatatgtctgatatggt gatatgaaacggaaaaacatttaaaatcgTTCCGTGCGCTGTTTTTTTCA GTGCTTTCCGATCACAGCTTTTTAATTCCCTTAGATAATGACTCTttata aaattcttttgtttctgtGTTTTAGCCCTGAAGGTGCAAACTTCAAAACC TTAACCAGCAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGGC GTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCCG ATCGAGAGTTCCACTAAAGTTCGCTTTCCAGTACAAAAACCTTGTTTGTA TATAAGTGTACTTTTGAATTTTGTATTTAGATCCTTCTATTTAGGATCAA TTCTGTAACTATttagtttatttgtttttggtAAAGTTTAACCCATTGta taatttttagttttggtttcttttgtaAAATCTTTGTTGTAAGatatatt gttttgttttgtttaaaaagaaacttcCGATATGTTCGATTAAGACCAGA ATATACCTTTTCGTTTTTTTACATGGTAGCCAACTCTTGCCAGGGACGGT TGGGATCACAGATTTCTGTGTCCAAAGGGCCAAGCAAACGAACTTTATGC TGAATTGAACT

Coding sequence (CDS) from alignment at sc0000001:1005161..1016571+

>TCONS_00000037 ID=TCONS_00000037|Name=TCONS_00000037|organism=Clytia hemisphaerica|type=CDS|length=13710bp|location=Sequence derived from alignment at sc0000001:1005161..1016571+ (Clytia hemisphaerica)
ATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCTGCAAGCTGTTT
GCCCTCTATTGGAGGTTGTGCAGCAAGTCAGaTTGCTTGTTGTTGTGGGT
CTGCTGCTTGCAGTTTATGTTGTAAAGCATGTCCATCTTGTCAAAATTCA
ACTGCTTCAAGGATTGGTTACACACTGGTACTCCTGCTTGGATTTATTCT
ATCATGTGTCATGTTGTCACCAAACATCCGTCAGAAATTGAATAAAGTAC
CTCACTTATGTCCAACATTTGATTGTGACCAGGTTGTTGGTTATGTGGCG
GTTTATCGTGTTTGCTTTGCAATGTTTGCTTTTTTCTTCATAATGGCTTT
GATCACGTTTAAAATTCGTAACAGCAAAGATCCAAGAGCTAGTATACACA
ATGGgttTTGGGCAATCAAACTACTCGTTTTCATTGCACTACTGGTCGGT
GCTTTTTACATTCCAAAAGGTGACTTCTCTAGGGTTTGGATGTATATTGG
TATGATTGGTGGCTTCTTGTTTATCTTGATCCAATTGGTTCTGTTGATTG
ATTTCGCTTATAGCTGGTCACAGAAATGGATTGGCAAGTATGAGGAAACT
GACAACAAGATTTGGTTCATTGGACTGGCTGTATGTACTGGAGGGTTGTA
TGCAATCGCGTTGGCCATCACTATTTGTGGTTTCATTTTCTATACTAAGA
CTTCAGGATGTGGATTGAACAAattctttttgagtttcaactTCATCATT
GCCGTTCTTCTGTCACTCATTTCCATTCATCCTCGTGTCCAAGAATCACA
ACCAACGTCAGGGCTGCTTCAAGCGTCCATCATTTCTGCATACAGCATGT
ATTTGACATTGTCCGCCATGTCTAATGAACCTGGCACAGATTGCAATCCA
GGTAGTTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGTTTCGACACACA
AACAGTGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTG
TGAGAACCAGTGCCAAAAGTTCTTCACTTTCCATCCAATCAGATGATGCA
GACATCGAAGAAGTTTTGCTAATCGAAAATAATGGACAGGGTGATGACGA
CGTGGAATACAAAGGACAAAAAGTTTACGATAACGAGAGTACAGAAGTTG
CATACAATtattcattctttcatttcactTATGCATTGGCCTCACTCTAT
ATCATGATGATGTTGACCAACTGGTACAGCCCTGAAGGTGCAAACTTCAA
AACCTTAACCAGCAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTT
GGGCGTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTT
CCCGATCGAGAGTTCCACTAAATGGGAAGTTTATTGAGTCTTATCGGCAT
TGGTTCAGCTGCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTC
AGaTTGCTTGTTGTTGTGGGTCTGCTGCTTGCAGTTTATGTTGTAAAGCA
TGTCCATCTTGTCAAAATTCAACTGCTTCAAGGATTGGTTACACACTGGT
ACTCCTGCTTGGATTTATTCTATCATGTGTCATGTTGTCACCAAACATCC
GTCAGAAATTGAATAAAGTACCTCACTTATGTCCAACATTTGATTGTGAC
CAGGTTGTTGGTTATGTGGCGGTTTATCGTGTTTGCTTTGCAATGTTTGC
TTTTTTCTTCATAATGGCTTTGATCACGTTTAAAATTCGTAACAGCAAAG
ATCCAAGAGCTAGTATACACAATGGgttTTGGGCAATCAAACTACTCGTT
TTCATTGCACTACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTTCTC
TAGGGTTTGGATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGA
TCCAATTGGTTCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGG
ATTGGCAAGTATGAGGAAACTGACAACAAGATTTGGTTCATTGGACTGGC
TGTATGTACTGGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTG
GTTTCATTTTCTATACTAAGACTTCAGGATGTGGATTGAACAAattcttt
ttgagtttcaactTCATCATTGCCGTTCTTCTGTCACTCATTTCCATTCA
TCCTCGTGTCCAAGAATCACAACCAACGTCAGGGCTGCTTCAAGCGTCCA
TCATTTCTGCATACAGCATGTATTTGACATTGTCCGCCATGTCTAATGAA
CCTGGCACAGATTGCAATCCAGGTAGTTCCTTCTTGCAAAGTGATTCTTT
CGCACCTGGTTTCGACACACAAACAGTGTTGGCAGCCATCTTTCTTTTTT
GCACGGTCGTCTATTCGTGTGTGAGAACCAGTGCCAAAAGTTCTTCACTT
TCCATCCAATCAGATGATGCAGACATCGAAGAAGTTTTGCTAATCGAAAA
TAATGGACAGGGTGATGACGACGTGGAATACAAAGGACAAAAAGTTTACG
ATAACGAGAGTACAGAAGTTGCATACAATtattcattctttcatttcact
TATGCATTGGCCTCACTCTATATCATGATGATGTTGACCAACTGGTACAG
CCCTGAAGGTGCAAACTTCAAAACCTTAACCAGCAGCATGGCTACAGTTT
GGGTCAAGATGGCGTCAAGTTGGGCGTGTTTCGTCCTCTTTGGGTGGACT
CTTGTCGCGCCTATGCTTTTTCCCGATCGAGAGTTCCACTAAATGGGAAG
TTTATTGAGTCTTATCGGCATTGGTTCAGCTGCAAGCTGTTTGCCCTCTA
TTGGAGGTTGTGCAGCAAGTCAGaTTGCTTGTTGTTGTGGGTCTGCTGCT
TGCAGTTTATGTTGTAAAGCATGTCCATCTTGTCAAAATTCAACTGCTTC
AAGGATTGGTTACACACTGGTACTCCTGCTTGGATTTATTCTATCATGTG
TCATGTTGTCACCAAACATCCGTCAGAAATTGAATAAAGTACCTCACTTA
TGTCCAACATTTGATTGTGACCAGGTTGTTGGTTATGTGGCGGTTTATCG
TGTTTGCTTTGCAATGTTTGCTTTTTTCTTCATAATGGCTTTGATCACGT
TTAAAATTCGTAACAGCAAAGATCCAAGAGCTAGTATACACAATGGgttT
TGGGCAATCAAACTACTCGTTTTCATTGCACTACTGGTCGGTGCTTTTTA
CATTCCAAAAGGTGACTTCTCTAGGGTTTGGATGTATATTGGTATGATTG
GTGGCTTCTTGTTTATCTTGATCCAATTGGTTCTGTTGATTGATTTCGCT
TATAGCTGGTCACAGAAATGGATTGGCAAGTATGAGGAAACTGACAACAA
GATTTGGTTCATTGGACTGGCTGTATGTACTGGAGGGTTGTATGCAATCG
CGTTGGCCATCACTATTTGTGGTTTCATTTTCTATACTAAGACTTCAGGA
TGTGGATTGAACAAattctttttgagtttcaactTCATCATTGCCGTTCT
TCTGTCACTCATTTCCATTCATCCTCGTGTCCAAGAATCACAACCAACGT
CAGGGCTGCTTCAAGCGTCCATCATTTCTGCATACAGCATGTATTTGACA
TTGTCCGCCATGTCTAATGAACCTGGCACAGATTGCAATCCAGGTAGTTC
CTTCTTGCAAAGTGATTCTTTCGCACCTGGTTTCGACACACAAACAGTGT
TGGCAGCCATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTGTGAGAACC
AGTGCCAAAAGTTCTTCACTTTCCATCCAATCAGATGATGCAGACATCGA
AGAAGTTTTGCTAATCGAAAATAATGGACAGGGTGATGACGACGTGGAAT
ACAAAGGACAAAAAGTTTACGATAACGAGAGTACAGAAGTTGCATACAAT
tattcattctttcatttcactTATGCATTGGCCTCACTCTATATCATGAT
GATGTTGACCAACTGGTACAGCCCTGAAGGTGCAAACTTCAAAACCTTAA
CCAGCAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGGCGTGT
TTCGTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCCGATCG
AGAGTTCCACTAAATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAG
CTGCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGaTTGCT
TGTTGTTGTGGGTCTGCTGCTTGCAGTTTATGTTGTAAAGCATGTCCATC
TTGTCAAAATTCAACTGCTTCAAGGATTGGTTACACACTGGTACTCCTGC
TTGGATTTATTCTATCATGTGTCATGTTGTCACCAAACATCCGTCAGAAA
TTGAATAAAGTACCTCACTTATGTCCAACATTTGATTGTGACCAGGTTGT
TGGTTATGTGGCGGTTTATCGTGTTTGCTTTGCAATGTTTGCTTTTTTCT
TCATAATGGCTTTGATCACGTTTAAAATTCGTAACAGCAAAGATCCAAGA
GCTAGTATACACAATGGgttTTGGGCAATCAAACTACTCGTTTTCATTGC
ACTACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTTCTCTAGGGTTT
GGATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATCCAATTG
GTTCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGGATTGGCAA
GTATGAGGAAACTGACAACAAGATTTGGTTCATTGGACTGGCTGTATGTA
CTGGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTGGTTTCATT
TTCTATACTAAGACTTCAGGATGTGGATTGAACAAattctttttgagttt
caactTCATCATTGCCGTTCTTCTGTCACTCATTTCCATTCATCCTCGTG
TCCAAGAATCACAACCAACGTCAGGGCTGCTTCAAGCGTCCATCATTTCT
GCATACAGCATGTATTTGACATTGTCCGCCATGTCTAATGAACCTGGCAC
AGATTGCAATCCAGGTAGTTCCTTCTTGCAAAGTGATTCTTTCGCACCTG
GTTTCGACACACAAACAGTGTTGGCAGCCATCTTTCTTTTTTGCACGGTC
GTCTATTCGTGTGTGAGAACCAGTGCCAAAAGTTCTTCACTTTCCATCCA
ATCAGATGATGCAGACATCGAAGAAGTTTTGCTAATCGAAAATAATGGAC
AGGGTGATGACGACGTGGAATACAAAGGACAAAAAGTTTACGATAACGAG
AGTACAGAAGTTGCATACAATtattcattctttcatttcactTATGCATT
GGCCTCACTCTATATCATGATGATGTTGACCAACTGGTACAGCCCTGAAG
GTGCAAACTTCAAAACCTTAACCAGCAGCATGGCTACAGTTTGGGTCAAG
ATGGCGTCAAGTTGGGCGTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGC
GCCTATGCTTTTTCCCGATCGAGAGTTCCACTAAATGGGAAGTTTATTGA
GTCTTATCGGCATTGGTTCAGCTGCAAGCTGTTTGCCCTCTATTGGAGGT
TGTGCAGCAAGTCAGaTTGCTTGTTGTTGTGGGTCTGCTGCTTGCAGTTT
ATGTTGTAAAGCATGTCCATCTTGTCAAAATTCAACTGCTTCAAGGATTG
GTTACACACTGGTACTCCTGCTTGGATTTATTCTATCATGTGTCATGTTG
TCACCAAACATCCGTCAGAAATTGAATAAAGTACCTCACTTATGTCCAAC
ATTTGATTGTGACCAGGTTGTTGGTTATGTGGCGGTTTATCGTGTTTGCT
TTGCAATGTTTGCTTTTTTCTTCATAATGGCTTTGATCACGTTTAAAATT
CGTAACAGCAAAGATCCAAGAGCTAGTATACACAATGGgttTTGGGCAAT
CAAACTACTCGTTTTCATTGCACTACTGGTCGGTGCTTTTTACATTCCAA
AAGGTGACTTCTCTAGGGTTTGGATGTATATTGGTATGATTGGTGGCTTC
TTGTTTATCTTGATCCAATTGGTTCTGTTGATTGATTTCGCTTATAGCTG
GTCACAGAAATGGATTGGCAAGTATGAGGAAACTGACAACAAGATTTGGT
TCATTGGACTGGCTGTATGTACTGGAGGGTTGTATGCAATCGCGTTGGCC
ATCACTATTTGTGGTTTCATTTTCTATACTAAGACTTCAGGATGTGGATT
GAACAAattctttttgagtttcaactTCATCATTGCCGTTCTTCTGTCAC
TCATTTCCATTCATCCTCGTGTCCAAGAATCACAACCAACGTCAGGGCTG
CTTCAAGCGTCCATCATTTCTGCATACAGCATGTATTTGACATTGTCCGC
CATGTCTAATGAACCTGGCACAGATTGCAATCCAGGTAGTTCCTTCTTGC
AAAGTGATTCTTTCGCACCTGGTTTCGACACACAAACAGTGTTGGCAGCC
ATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTGTGAGAACCAGTGCCAA
AAGTTCTTCACTTTCCATCCAATCAGATGATGCAGACATCGAAGAAGTTT
TGCTAATCGAAAATAATGGACAGGGTGATGACGACGTGGAATACAAAGGA
CAAAAAGTTTACGATAACGAGAGTACAGAAGTTGCATACAATtattcatt
ctttcatttcactTATGCATTGGCCTCACTCTATATCATGATGATGTTGA
CCAACTGGTACAGCCCTGAAGGTGCAAACTTCAAAACCTTAACCAGCAGC
ATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGGCGTGTTTCGTCCT
CTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCCGATCGAGAGTTCC
ACTAAATGGGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCTGCAAGC
TGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGaTTGCTTGTTGTTG
TGGGTCTGCTGCTTGCAGTTTATGTTGTAAAGCATGTCCATCTTGTCAAA
ATTCAACTGCTTCAAGGATTGGTTACACACTGGTACTCCTGCTTGGATTT
ATTCTATCATGTGTCATGTTGTCACCAAACATCCGTCAGAAATTGAATAA
AGTACCTCACTTATGTCCAACATTTGATTGTGACCAGGTTGTTGGTTATG
TGGCGGTTTATCGTGTTTGCTTTGCAATGTTTGCTTTTTTCTTCATAATG
GCTTTGATCACGTTTAAAATTCGTAACAGCAAAGATCCAAGAGCTAGTAT
ACACAATGGgttTTGGGCAATCAAACTACTCGTTTTCATTGCACTACTGG
TCGGTGCTTTTTACATTCCAAAAGGTGACTTCTCTAGGGTTTGGATGTAT
ATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATCCAATTGGTTCTGTT
GATTGATTTCGCTTATAGCTGGTCACAGAAATGGATTGGCAAGTATGAGG
AAACTGACAACAAGATTTGGTTCATTGGACTGGCTGTATGTACTGGAGGG
TTGTATGCAATCGCGTTGGCCATCACTATTTGTGGTTTCATTTTCTATAC
TAAGACTTCAGGATGTGGATTGAACAAattctttttgagtttcaactTCA
TCATTGCCGTTCTTCTGTCACTCATTTCCATTCATCCTCGTGTCCAAGAA
TCACAACCAACGTCAGGGCTGCTTCAAGCGTCCATCATTTCTGCATACAG
CATGTATTTGACATTGTCCGCCATGTCTAATGAACCTGGCACAGATTGCA
ATCCAGGTAGTTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGTTTCGAC
ACACAAACAGTGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGTCTATTC
GTGTGTGAGAACCAGTGCCAAAAGTTCTTCACTTTCCATCCAATCAGATG
ATGCAGACATCGAAGAAGTTTTGCTAATCGAAAATAATGGACAGGGTGAT
GACGACGTGGAATACAAAGGACAAAAAGTTTACGATAACGAGAGTACAGA
AGTTGCATACAATtattcattctttcatttcactTATGCATTGGCCTCAC
TCTATATCATGATGATGTTGACCAACTGGTACAGCCCTGAAGGTGCAAAC
TTCAAAACCTTAACCAGCAGCATGGCTACAGTTTGGGTCAAGATGGCGTC
AAGTTGGGCGTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGC
TTTTTCCCGATCGAGAGTTCCACTAAATGGGAAGTTTATTGAGTCTTATC
GGCATTGGTTCAGCTGCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGC
AAGTCAGaTTGCTTGTTGTTGTGGGTCTGCTGCTTGCAGTTTATGTTGTA
AAGCATGTCCATCTTGTCAAAATTCAACTGCTTCAAGGATTGGTTACACA
CTGGTACTCCTGCTTGGATTTATTCTATCATGTGTCATGTTGTCACCAAA
CATCCGTCAGAAATTGAATAAAGTACCTCACTTATGTCCAACATTTGATT
GTGACCAGGTTGTTGGTTATGTGGCGGTTTATCGTGTTTGCTTTGCAATG
TTTGCTTTTTTCTTCATAATGGCTTTGATCACGTTTAAAATTCGTAACAG
CAAAGATCCAAGAGCTAGTATACACAATGGgttTTGGGCAATCAAACTAC
TCGTTTTCATTGCACTACTGGTCGGTGCTTTTTACATTCCAAAAGGTGAC
TTCTCTAGGGTTTGGATGTATATTGGTATGATTGGTGGCTTCTTGTTTAT
CTTGATCCAATTGGTTCTGTTGATTGATTTCGCTTATAGCTGGTCACAGA
AATGGATTGGCAAGTATGAGGAAACTGACAACAAGATTTGGTTCATTGGA
CTGGCTGTATGTACTGGAGGGTTGTATGCAATCGCGTTGGCCATCACTAT
TTGTGGTTTCATTTTCTATACTAAGACTTCAGGATGTGGATTGAACAAat
tctttttgagtttcaactTCATCATTGCCGTTCTTCTGTCACTCATTTCC
ATTCATCCTCGTGTCCAAGAATCACAACCAACGTCAGGGCTGCTTCAAGC
GTCCATCATTTCTGCATACAGCATGTATTTGACATTGTCCGCCATGTCTA
ATGAACCTGGCACAGATTGCAATCCAGGTAGTTCCTTCTTGCAAAGTGAT
TCTTTCGCACCTGGTTTCGACACACAAACAGTGTTGGCAGCCATCTTTCT
TTTTTGCACGGTCGTCTATTCGTGTGTGAGAACCAGTGCCAAAAGTTCTT
CACTTTCCATCCAATCAGATGATGCAGACATCGAAGAAGTTTTGCTAATC
GAAAATAATGGACAGGGTGATGACGACGTGGAATACAAAGGACAAAAAGT
TTACGATAACGAGAGTACAGAAGTTGCATACAATtattcattctttcatt
tcactTATGCATTGGCCTCACTCTATATCATGATGATGTTGACCAACTGG
TACAGCCCTGAAGGTGCAAACTTCAAAACCTTAACCAGCAGCATGGCTAC
AGTTTGGGTCAAGATGGCGTCAAGTTGGGCGTGTTTCGTCCTCTTTGGGT
GGACTCTTGTCGCGCCTATGCTTTTTCCCGATCGAGAGTTCCACTAAATG
GGAAGTTTATTGAGTCTTATCGGCATTGGTTCAGCTGCAAGCTGTTTGCC
CTCTATTGGAGGTTGTGCAGCAAGTCAGaTTGCTTGTTGTTGTGGGTCTG
CTGCTTGCAGTTTATGTTGTAAAGCATGTCCATCTTGTCAAAATTCAACT
GCTTCAAGGATTGGTTACACACTGGTACTCCTGCTTGGATTTATTCTATC
ATGTGTCATGTTGTCACCAAACATCCGTCAGAAATTGAATAAAGTACCTC
ACTTATGTCCAACATTTGATTGTGACCAGGTTGTTGGTTATGTGGCGGTT
TATCGTGTTTGCTTTGCAATGTTTGCTTTTTTCTTCATAATGGCTTTGAT
CACGTTTAAAATTCGTAACAGCAAAGATCCAAGAGCTAGTATACACAATG
GgttTTGGGCAATCAAACTACTCGTTTTCATTGCACTACTGGTCGGTGCT
TTTTACATTCCAAAAGGTGACTTCTCTAGGGTTTGGATGTATATTGGTAT
GATTGGTGGCTTCTTGTTTATCTTGATCCAATTGGTTCTGTTGATTGATT
TCGCTTATAGCTGGTCACAGAAATGGATTGGCAAGTATGAGGAAACTGAC
AACAAGATTTGGTTCATTGGACTGGCTGTATGTACTGGAGGGTTGTATGC
AATCGCGTTGGCCATCACTATTTGTGGTTTCATTTTCTATACTAAGACTT
CAGGATGTGGATTGAACAAattctttttgagtttcaactTCATCATTGCC
GTTCTTCTGTCACTCATTTCCATTCATCCTCGTGTCCAAGAATCACAACC
AACGTCAGGGCTGCTTCAAGCGTCCATCATTTCTGCATACAGCATGTATT
TGACATTGTCCGCCATGTCTAATGAACCTGGCACAGATTGCAATCCAGGT
AGTTCCTTCTTGCAAAGTGATTCTTTCGCACCTGGTTTCGACACACAAAC
AGTGTTGGCAGCCATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTGTGA
GAACCAGTGCCAAAAGTTCTTCACTTTCCATCCAATCAGATGATGCAGAC
ATCGAAGAAGTTTTGCTAATCGAAAATAATGGACAGGGTGATGACGACGT
GGAATACAAAGGACAAAAAGTTTACGATAACGAGAGTACAGAAGTTGCAT
ACAATtattcattctttcatttcactTATGCATTGGCCTCACTCTATATC
ATGATGATGTTGACCAACTGGTACAGCCCTGAAGGTGCAAACTTCAAAAC
CTTAACCAGCAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGG
CGTGTTTCGTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCC
GATCGAGAGTTCCACTAAATGGGAAGTTTATTGAGTCTTATCGGCATTGG
TTCAGCTGCAAGCTGTTTGCCCTCTATTGGAGGTTGTGCAGCAAGTCAGa
TTGCTTGTTGTTGTGGGTCTGCTGCTTGCAGTTTATGTTGTAAAGCATGT
CCATCTTGTCAAAATTCAACTGCTTCAAGGATTGGTTACACACTGGTACT
CCTGCTTGGATTTATTCTATCATGTGTCATGTTGTCACCAAACATCCGTC
AGAAATTGAATAAAGTACCTCACTTATGTCCAACATTTGATTGTGACCAG
GTTGTTGGTTATGTGGCGGTTTATCGTGTTTGCTTTGCAATGTTTGCTTT
TTTCTTCATAATGGCTTTGATCACGTTTAAAATTCGTAACAGCAAAGATC
CAAGAGCTAGTATACACAATGGgttTTGGGCAATCAAACTACTCGTTTTC
ATTGCACTACTGGTCGGTGCTTTTTACATTCCAAAAGGTGACTTCTCTAG
GGTTTGGATGTATATTGGTATGATTGGTGGCTTCTTGTTTATCTTGATCC
AATTGGTTCTGTTGATTGATTTCGCTTATAGCTGGTCACAGAAATGGATT
GGCAAGTATGAGGAAACTGACAACAAGATTTGGTTCATTGGACTGGCTGT
ATGTACTGGAGGGTTGTATGCAATCGCGTTGGCCATCACTATTTGTGGTT
TCATTTTCTATACTAAGACTTCAGGATGTGGATTGAACAAattctttttg
agtttcaactTCATCATTGCCGTTCTTCTGTCACTCATTTCCATTCATCC
TCGTGTCCAAGAATCACAACCAACGTCAGGGCTGCTTCAAGCGTCCATCA
TTTCTGCATACAGCATGTATTTGACATTGTCCGCCATGTCTAATGAACCT
GGCACAGATTGCAATCCAGGTAGTTCCTTCTTGCAAAGTGATTCTTTCGC
ACCTGGTTTCGACACACAAACAGTGTTGGCAGCCATCTTTCTTTTTTGCA
CGGTCGTCTATTCGTGTGTGAGAACCAGTGCCAAAAGTTCTTCACTTTCC
ATCCAATCAGATGATGCAGACATCGAAGAAGTTTTGCTAATCGAAAATAA
TGGACAGGGTGATGACGACGTGGAATACAAAGGACAAAAAGTTTACGATA
ACGAGAGTACAGAAGTTGCATACAATtattcattctttcatttcactTAT
GCATTGGCCTCACTCTATATCATGATGATGTTGACCAACTGGTACAGCCC
TGAAGGTGCAAACTTCAAAACCTTAACCAGCAGCATGGCTACAGTTTGGG
TCAAGATGGCGTCAAGTTGGGCGTGTTTCGTCCTCTTTGGGTGGACTCTT
GTCGCGCCTATGCTTTTTCCCGATCGAGAGTTCCACTAAATGGGAAGTTT
ATTGAGTCTTATCGGCATTGGTTCAGCTGCAAGCTGTTTGCCCTCTATTG
GAGGTTGTGCAGCAAGTCAGaTTGCTTGTTGTTGTGGGTCTGCTGCTTGC
AGTTTATGTTGTAAAGCATGTCCATCTTGTCAAAATTCAACTGCTTCAAG
GATTGGTTACACACTGGTACTCCTGCTTGGATTTATTCTATCATGTGTCA
TGTTGTCACCAAACATCCGTCAGAAATTGAATAAAGTACCTCACTTATGT
CCAACATTTGATTGTGACCAGGTTGTTGGTTATGTGGCGGTTTATCGTGT
TTGCTTTGCAATGTTTGCTTTTTTCTTCATAATGGCTTTGATCACGTTTA
AAATTCGTAACAGCAAAGATCCAAGAGCTAGTATACACAATGGgttTTGG
GCAATCAAACTACTCGTTTTCATTGCACTACTGGTCGGTGCTTTTTACAT
TCCAAAAGGTGACTTCTCTAGGGTTTGGATGTATATTGGTATGATTGGTG
GCTTCTTGTTTATCTTGATCCAATTGGTTCTGTTGATTGATTTCGCTTAT
AGCTGGTCACAGAAATGGATTGGCAAGTATGAGGAAACTGACAACAAGAT
TTGGTTCATTGGACTGGCTGTATGTACTGGAGGGTTGTATGCAATCGCGT
TGGCCATCACTATTTGTGGTTTCATTTTCTATACTAAGACTTCAGGATGT
GGATTGAACAAattctttttgagtttcaactTCATCATTGCCGTTCTTCT
GTCACTCATTTCCATTCATCCTCGTGTCCAAGAATCACAACCAACGTCAG
GGCTGCTTCAAGCGTCCATCATTTCTGCATACAGCATGTATTTGACATTG
TCCGCCATGTCTAATGAACCTGGCACAGATTGCAATCCAGGTAGTTCCTT
CTTGCAAAGTGATTCTTTCGCACCTGGTTTCGACACACAAACAGTGTTGG
CAGCCATCTTTCTTTTTTGCACGGTCGTCTATTCGTGTGTGAGAACCAGT
GCCAAAAGTTCTTCACTTTCCATCCAATCAGATGATGCAGACATCGAAGA
AGTTTTGCTAATCGAAAATAATGGACAGGGTGATGACGACGTGGAATACA
AAGGACAAAAAGTTTACGATAACGAGAGTACAGAAGTTGCATACAATtat
tcattctttcatttcactTATGCATTGGCCTCACTCTATATCATGATGAT
GTTGACCAACTGGTACAGCCCTGAAGGTGCAAACTTCAAAACCTTAACCA
GCAGCATGGCTACAGTTTGGGTCAAGATGGCGTCAAGTTGGGCGTGTTTC
GTCCTCTTTGGGTGGACTCTTGTCGCGCCTATGCTTTTTCCCGATCGAGA
GTTCCACTAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000024XLOC_000024Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000037-proteinTCONS_00000037-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000037-exon-sc0000001-1491911889:1005161..1005552TCONS_00000037-exon-sc0000001-1491911889:1005161..1005552Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1005161..1005552TCONS_00000037-exon-sc0000001-1510915933:1005161..1005552Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1005161..1005552TCONS_00000037-exon-sc0000001-1575043694:1005161..1005552Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1009180..1009502TCONS_00000037-exon-sc0000001-1491911889:1009180..1009502Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1009180..1009502TCONS_00000037-exon-sc0000001-1510915933:1009180..1009502Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1009180..1009502TCONS_00000037-exon-sc0000001-1575043694:1009180..1009502Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1010089..1010168TCONS_00000037-exon-sc0000001-1491911889:1010089..1010168Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1010089..1010168TCONS_00000037-exon-sc0000001-1510915933:1010089..1010168Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1010089..1010168TCONS_00000037-exon-sc0000001-1575043694:1010089..1010168Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1010514..1010607TCONS_00000037-exon-sc0000001-1491911889:1010514..1010607Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1010514..1010607TCONS_00000037-exon-sc0000001-1510915933:1010514..1010607Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1010514..1010607TCONS_00000037-exon-sc0000001-1575043694:1010514..1010607Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1011284..1011327TCONS_00000037-exon-sc0000001-1491911889:1011284..1011327Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1011284..1011327TCONS_00000037-exon-sc0000001-1510915933:1011284..1011327Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1011284..1011327TCONS_00000037-exon-sc0000001-1575043694:1011284..1011327Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1011753..1011829TCONS_00000037-exon-sc0000001-1491911889:1011753..1011829Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1011753..1011829TCONS_00000037-exon-sc0000001-1510915933:1011753..1011829Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1011753..1011829TCONS_00000037-exon-sc0000001-1575043694:1011753..1011829Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1012339..1012540TCONS_00000037-exon-sc0000001-1491911889:1012339..1012540Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1012339..1012540TCONS_00000037-exon-sc0000001-1510915933:1012339..1012540Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1012339..1012540TCONS_00000037-exon-sc0000001-1575043694:1012339..1012540Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1013757..1013953TCONS_00000037-exon-sc0000001-1491911889:1013757..1013953Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1013757..1013953TCONS_00000037-exon-sc0000001-1510915933:1013757..1013953Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1013757..1013953TCONS_00000037-exon-sc0000001-1575043694:1013757..1013953Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1014891..1015021TCONS_00000037-exon-sc0000001-1491911889:1014891..1015021Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1014891..1015021TCONS_00000037-exon-sc0000001-1510915933:1014891..1015021Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1014891..1015021TCONS_00000037-exon-sc0000001-1575043694:1014891..1015021Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1491911889:1016086..1016571TCONS_00000037-exon-sc0000001-1491911889:1016086..1016571Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1510915933:1016086..1016571TCONS_00000037-exon-sc0000001-1510915933:1016086..1016571Clytia hemisphaericaexon
TCONS_00000037-exon-sc0000001-1575043694:1016086..1016571TCONS_00000037-exon-sc0000001-1575043694:1016086..1016571Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:1005161..1016571 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
114.131 112.784 92.2328 78.4349 4.43344 1.41632 9.65775 13.359 23.3162 19.8498 21.5765 21.9968 25.209 26.2647 26.8931 28.4128 32.1641 39.2622 35.0997 36.8064 48.438 44.9226 46.0064 49.9648 0 0 28.0701 38.8693 30.5756 31.2237
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR005016TDE1/TMS
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0016020 membrane
Blast
BLAST of TCONS_00000037 vs. Swiss-Prot (Human)
Match: SERC3 (Serine incorporator 3 OS=Homo sapiens GN=SERINC3 PE=2 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 1.695e-95
Identity = 194/445 (43.60%), Postives = 268/445 (60.22%), Query Frame = 3
Query:  453 QNSTASRIGYTLVLLLGFILSCVMLSPNIRQKLNKVPHLCP------------TFDCDQVVGYVAVYRVCXXXXXXXXXXXLITFKIRNSKDPRASIHNGFWAIKLLVFIALLVGAFYIPKGDFSRVWMYXXXXXXXXXXXXXXXXXXXXAYSWSQKWIGKYEETDNKIWFIGLAVCTGGLYAIALAITICGFIFYTKTSGCGLNKFFLSFNFIIAVLLSLISIHPRVQESQPTSGLLQASIISAYSMYLTLSAMSNEPGTDCNPG-SSF---LQSDSFAPGFDTQTVLAA-------------------IFLFCTVVYSCVRTSAKSSSLSIQSDDADIEEVLLIENNGQGDDDVEYKGQ--KVYDNESTEVAYNYSFFHFTYALASLYIMMMLTNWYSPEGANFKTLTSSMATVWVKMASSWACFVLFGWTLVAPMLFPDREF 1676
            +NST +R+ Y  +LLL  ++S +M    +   L K+P  C               DCD +VGY AVYR+ FAM  FFF+ +L+ FK++ SKD RA++HNGFW  K+   I ++VG+FYIP G FS VW  +GMIG  LFILIQLVLL+DFA+SW++ W+ + EE + ++W+  L   T   Y +++      + +YTK  GC  NKFF+S N I+ V+ S+ISIHP++QE QP SGLLQ+S+I+ Y+MYLT SAMSNEP   CNP   SF   + + + APG  T  V                      +F+ C ++YS +RTS  S    +    +D   V+L +    G  D E  GQ  +  DNE   V Y+YS FH    LASLYIMM LT+WYSP+ A F+++TS    VWVK++SSW C +L+ WTLVAP++   R+F
Sbjct:   33 KNSTVTRLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAVYRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSSVWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSIICVGLLYTYYTKPDGCTENKFFISINLILCVVASIISIHPKIQEHQPRSGLLQSSLITLYTMYLTWSAMSNEPDRSCNPNLMSFITRITAPTLAPGNSTAVVPTPTPPSKSGSLLDSDNFIGLFVFVLC-LLYSSIRTSTNSQVDKLTLSGSD--SVILGDTTTSGASD-EEDGQPRRAVDNEKEGVQYSYSLFHLMLCLASLYIMMTLTSWYSPD-AKFQSMTSKWPAVWVKISSSWVCLLLYVWTLVAPLVLTSRDF 472          
The following BLAST results are available for this feature:
BLAST of TCONS_00000037 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
SERC31.695e-9543.60Serine incorporator 3 OS=Homo sapiens GN=SERINC3 P... [more]
back to top