Error message

Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).

TCONS_00000028 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000028
Unique NameTCONS_00000028
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2171

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000028 ID=TCONS_00000028|Name=TCONS_00000028|organism=Clytia hemisphaerica|type=transcript|length=2171bp
TAACAAAACAAGGATTTTGTAACAAAATGATCCTAACaagaatgaaagaa
aaaatacaaattattttataggttaaataCTACGAATTAAAATAACCCTA
CGAaagaaatttcaatgaaaaattgcCAAAGATGACAGTCGAAATTGATG
TCCCGAATATGGGACCTAACTTCTGTGAAAAAGGTCCcccaaaatgataa
attttctgCTCCAAACTAAGTTGATTGTTAACTTGACTGGGTGATCCTGT
TAATAGAAACTAAAGGTGACTTTAAAAATTCTACACAAACAAGACAAGAA
CTTACACAAGAGTTTTTAAAAACCCACCGAAATATAAACATTATTTCAAG
TACTATTTCTAAAGTTTCATTGTCACAGTTTGAGATTCCACACTATTAAC
CAACAAAACATTATTGACAGGAACAAATTGCCCTGTGATCATTTTAATGA
CCTCTTGGGCGCTTATTCCACCCATCACAGCCGCCATAGGGTGGAATTCA
GAGAGGTCTGAACGTAACATTTCTTCTAAAATGTTTAAAGGTGATTCAAA
CTCTTCTAACAAACAGCTTTTCATGACGTTTTCAGTGACAGATGACAAAG
AGATTAAATCTTTAGGTGCTTGTTGGTCAAGGGATGAATGTAATGTACGG
AAGGCTAGATACAAGCTAGCTCCATTTTCTTGATATTGTTCAAGGGTGTC
TTTGATTTTATGCTCTGCTAAATTCTGACGAATCTCGTCGTGATAGGAGA
GCCCATACTGCACTTGAATAAACGCAGCGTTTTTACAGAACGTTTGGATC
TCGTCAGGTTGAATAAAACTCAAAGACCTTTGGAGGTCTTCTAATGATTC
TCGAACAAGATCGGTCACTTTCTGTATATCACTTTCAGCTTTAGTTTTAT
AAACGTTCTGTAACTCAATATAGCGTTTCGAATCTGAGAACATGTCTGGT
AAAGAGCCACGTAAAGGTAGTGTACCACTCTGGTTAACAAACTCTTTGAG
AGCTCTAACGAGAATCCAGAATTTTGAATTGTTTGCAGATTGGAGGGGAT
GATCAGCCATTGGATTATCAAGAACGTTACGAACATCAGATGGTACAAAC
GTACCAGAAAAAACATTATTCACATTTGTCAACGCTTCTTCAAAATTCTC
TTCATGCACAGGAACGCCATCCTCGTTTTTCAAGTTTAAACTTCtcacaa
tttctttaatttggcatttttctttgtaatttttggGCCATTTTTGATCT
GTTTGTTCTTGCCACCGTTCAAGGGCTTTGTAAAGAACCACAAGGAATGG
TGTGTGTGAATGCTCCAGATTATCCATAGTAGATAAGTCCATTTTATTGA
AATAATCAACTAGCTCCGGAAACGGGCAATCTAATCTCAAATCGGAATGA
GTATTATCAGGATGTGCTTTAATGATGACATGCTCTTTGTAAACCAATCT
TAAATAACCAAACATTCCAACACTGTCCACAATAAATAACGGAATATCAT
GTTCCCAAAAATAATGACTGAGTTTCAATAAATCATGTTCTGAAACGCGT
GAGCAAATAACTGCGGTAAATTTACGGTAAAATTCTGGGTCATTATCTAA
CAGGTTTGCCGCATTCTCTTTAATCCAATTACCACTGGTATCTGGATTCA
ACTCTTGAAGCAACTCACAGGCTACTTTAGCACGTGGTTTCCCAATAGAT
TCGGGATCAACAAAGAAATTACTACTTAGATCGTCATCATTGACCAAATG
ATCATCCACAATGTAAAATTTACCAATTCCTGGTAAAACAAGACATTTTA
AAGTTTCGGTTGCCGTTGCTGTAGCATTAATCAAGCAAATCCGAGCATTC
TCCAATGCTGTTTGGCCATCATTCCCCCATAAACGTAATTGCCGATCATA
TTTTTGTTCCTTTTGTATAGGATcttgtttttggatttttttctttggat
tttcCAGTGTTTCACATTCCATTACTTCACTGTGgtgttttttattgtta
ttgtcagttgaagattcttttcttttcatgtTCTAACATTCTGAAACGAT
ACAAAAAACAAACTACTGTAATTGTGAATAGCAGGAAGGAGAATTGAAAA
CTTCGAAAACACAGTAGAATAATAACTTTTTAAAGAATCGTCTCTTAACC
AATTCTTGTGCTACAGCGTTT
Run BLAST on NCBI

transcript from alignment at sc0000001:752391..756932+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000028 ID=TCONS_00000028|Name=TCONS_00000028|organism=Clytia hemisphaerica|type=transcript|length=4542bp|location=Sequence derived from alignment at sc0000001:752391..756932+ (Clytia hemisphaerica)
TAACAAAACAAGGATTTTGTAACAAAATGATCCTAACaagaatgaaagaa aaaatacaaattattttatagcttaaccctttaagtgccgatgtcgtata tatacgacatgggctatataggagggcgaagccctcctgtaatgcccagt ttgagttagaaatcgttatttttgNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Nttccttctagatcaggagatataagcccttaaagtttgaactagcgatt ttttaaaaaaaacttagaaaaaaggaccctggcactcaaagggttaaata CTACGAATTAAAATAACCCTACGAaagaaatttcaatgaaaaattgcCAA AGATGACAGTCGAAATTGATGTCCCGAATATGGGACCTAACTTCTGTGAA AAAGGTCCcccaaaatgataaattttctgCTCCAAACTAAGTTGATTGTT AACTTGACTGGGTGATCCTGTTAATAGAAACTAAAGGTGACTTTAAAAAT TCTACACAAACAAGACAAGAACTTACACAAGAGTTTTTAAAAACCCACCG AAATATAAACATTATTTCAAGTACTATTTCTAAAGTTTCATTGTCACAGT TTGAGATTCCACACTATTAACCAACAAAACATTATTGACAGGAACAAATT GCCCTGTGATCATTTTAATGACCTCTTGGGCGCTTATTCCACCCATCACA GCCGCCATAGGGTGGAATTCAGAGAGGTCTGAACGTAACATTTCTTCTAA AATGTTTAAAGGTGATTCAAACTCTTCTAACAAACAGCTTTTCATGACGT TTTCAGTGACAGATGACAAAGAGATTAAATCTTTAGGTGCTTGTTGGTCA AGGGATGAATGTAATGTACGGAAGGCTAGATACAAGCTAGCTCCATTTTC TTGATATTGTTCAAGGGTGTCTTTGATTTTATGCTCTGCTAAATTCTGAC GAATCTCGTCGTGATAGGAGAGCCCATACTGCACTTGAATAAACGCAGCG TTTTTACAGAACGTTTGGATCTCGTCAGGTTGAATAAAACTCAAAGACCT TTGGAGGTCTTCTAATGATTCTCGAACAAGATCGGTCACTTTCTGTATAT CACTTTCAGCTTTAGTTTTATAAACGTTCTGTAACTCAATATAGCGTTTC GAATCTGAGAACATGTCTGGTAAAGAGCCACGTAAAGGTAGTGTACCACT CTGGTTAACAAACTCTTTGAGAGCTCTAACGAGAATCCAGAATTTTGAAT TGTTTGCAGATTGGAGGGGATGATCAGCCATTGGATTATCAAGAACGTTA CGAACATCAGATGGTACAAACGTACCAGAAAAAACATTATTCACATTTGT CAACGCTTCTTCAAAATTCTCTTCATGCACAGGAACGCCATCCTCGTTTT TCAAGTTTAAACTTCtcacaatttctttaatttggcatttttctttgtaa tttttggGCCATTTTTGATCTGTTTGTTCTTGCCACCGTTCAAGGGCTTT GTAAAGAACCACAAGGAATGGTGTGTGTGAATGCTCCAGATTATCCATAG TAGATAAGTCCATTTTATTGAAATAATCAACTAGCTCCGGAAACGGGCAA TCTAATCTCAAATCGGAATGAGTATTATCAGGATGTGCTTTAATGATGAC ATGCTCTTTGTAAACCAATCTTAAATAACCAAACATTCCAACACTGTCCA CAATAAATAACGGAATATCATGTTCCCAAAAATAATGACTGAGTTTCAAT AAATCATGTTCTGAAACGCGTGAGCAAATAACTGCGGTAAATTTACGGTA AAATTCTGGGTCATTATCTAACAGGTTTGCCGCATTCTCTTTAATCCAAT TACCACTGGTATCTGGATTCAACTCTTGAAGCAACTCACAGGCTACTTTA GCACGTGGTTTCCCAATAGATTCGGGATCAACAAAGAAATTACTACTTAG ATCGTCATCATTGACCAAATGATCATCCACAATGTAAAATTTACCAATTC CTGGTAAAACAAGACATTTTAAAGTTTCGGTTGCCGTTGCTGTAGCATTA ATCAAGCAAATCCGAGCATTCTCCAATGCTGTTTGGCCATCATTCCCCCA TAAACGTAATTGCCGATCATATTTTTGTTCCTTTTGTATAGGATcttgtt tttggatttttttctttggattttcCAGTGTTTCACATTCCATTACTTCA CTGTGgtgttttttattgttattgtcagttgaagattcttttcttttcat gtTCTAACATTCTGAAACGATACAAAAAACAAACTACTGTAATTGTGAAT AGCAGGAAGGAGAATTGAAAACTTCGAAAACACAGTAGAATAATAACTTT TTAAAGAATCGTCTCTTAACCAATTCTTGTGCTACAGCGTTT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000017XLOC_000017Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000028-exon-sc0000001-1491911889:752391..752460TCONS_00000028-exon-sc0000001-1491911889:752391..752460Clytia hemisphaericaexon
TCONS_00000028-exon-sc0000001-1510915933:752391..752460TCONS_00000028-exon-sc0000001-1510915933:752391..752460Clytia hemisphaericaexon
TCONS_00000028-exon-sc0000001-1575043694:752391..752460TCONS_00000028-exon-sc0000001-1575043694:752391..752460Clytia hemisphaericaexon
TCONS_00000028-exon-sc0000001-1491911889:754832..756932TCONS_00000028-exon-sc0000001-1491911889:754832..756932Clytia hemisphaericaexon
TCONS_00000028-exon-sc0000001-1510915933:754832..756932TCONS_00000028-exon-sc0000001-1510915933:754832..756932Clytia hemisphaericaexon
TCONS_00000028-exon-sc0000001-1575043694:754832..756932TCONS_00000028-exon-sc0000001-1575043694:754832..756932Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:752391..756932 +
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
92.5648 86.3345 57.7158 49.7006 25.8176 18.8359 15.9576 17.0632 13.592 13.3946 11.8896 9.78041 9.98053 6.6309 11.6026 12.5276 13.435 12.0255 7.70803 11.0191 13.5943 14.659 55.1497 46.0644 13.0434 15.1136 17.3727 15.6652 32.935 35.2528
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR030667APP-BP1
IPR000594ThiF_NAD_FAD-bd
Vocabulary: Molecular Function
TermDefinition
GO:0019781NEDD8 activating enzyme activity
GO:0008641small protein activating enzyme activity
Vocabulary: Biological Process
TermDefinition
GO:0045116protein neddylation
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0045116 protein neddylation
molecular_function GO:0019781 NEDD8 activating enzyme activity
molecular_function GO:0008641 small protein activating enzyme activity
Blast
BLAST of TCONS_00000028 vs. Swiss-Prot (Human)
Match: ULA1 (NEDD8-activating enzyme E1 regulatory subunit OS=Homo sapiens GN=NAE1 PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 4.874e-136
Identity = 227/534 (42.51%), Postives = 332/534 (62.17%), Query Frame = -2
Query:  362 YDRQLRLWGNDGQTALENARICLINATATATETLKCLVLPGIGKFYIVDDHLVNDDDLSSNFFVDPESIGKPRAKVACELLQELNPDTSGNWIKENAANLLDNDPEFYRKFTAVICSRVSEHDLLKLSHYFWEHDIPLFIVDSVGMFGYLRLVYKEHVIIKAHPDNTHSDLRLDCPFPELVDYFNKMDLSTMDNLEHSHTPFLVVLYKALERWQEQTDQKWPKNYKEKCQIKEIVRSLNLKNEDGVPVHEENFEEALTNVNNVFSGTFVPSDVRNVLDNPMADHPLQ-SANNSKFWILVRALKEFVNQ--SGTLPLRGSLPDMFSDSKRYIELQNVYKTKAESDIQKVTDLVRESLEDLQRSLSFIQPDEIQTFCKNAAFIQVQYGLSYHDEIR-QNLAEHKIKDTLEQYQ--------ENGASLYLAFRTLHSSLDQQAPKDLISLSSVTENV--MKSCL---LEEFESPLNI----LEEMLRSDLSEFHPMAAVMGGISAQEVIKMITGQFVPXXXXXXXNSVESQTVTMKL 1900
            YDRQLRLWG+ GQ ALE+A +CLINATAT TE LK LVLPGIG F I+D + V+ +D  +NFF+   SIGK RA+ A E LQELN D SG++++E+  NLLDNDP F+ +FT V+ +++ E   L+L+   W   IPL I  + G+ GY+R++ KEH +I++HPDN   DLRLD PFPEL ++F   DL  M+  +HSHTP++V++ K L +W  +T+ + PK YKEK   ++++R   LKNE+G P  EENFEEA+ NVN   + T +PS + ++ ++   D  +  +     FWIL RALKEFV +   G LP+RG++PDM +DS +YI+LQNVY+ KA+ D   V + V + L+ + ++   I   E++  C N+AF++V         +R ++LAE    DT+ + +        +N   LYL  R +     QQ     +S   V E++  +KSCL   L+E+   + +    + E  R   +E H +AA +GG +AQEVIK+IT QFV  NN  + + +   + T +L
Sbjct:   13 YDRQLRLWGDHGQEALESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSDVSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHPDNALEDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFND---DRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRV---------VRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL 534          
The following BLAST results are available for this feature:
BLAST of TCONS_00000028 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
ULA14.874e-13642.51NEDD8-activating enzyme E1 regulatory subunit OS=H... [more]
back to top