TCONS_00000016 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000016
Unique NameTCONS_00000016
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1106

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000016 ID=TCONS_00000016|Name=TCONS_00000016|organism=Clytia hemisphaerica|type=transcript|length=1106bp
aaattttttaaagttctcagaagactccagtggtgtatatcatgaataga
ttttaAAAATCCCAATCAGCCTAAAGTAGAAATTTGTCTCGTTTATTGTA
TTTTCTTATCATCTAGCAGATTATTCAATcaataataatttttaaaaaga
tcATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTG
GGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTC
AGTTCACTACAGGGCAACTATTGGTGTTGATTTTGCTTTGAAAGTGTTGA
ATTGGGATGACAAAACATTGATACGTCTACAGCTATGGGATATAGCagGA
CAAGAACGTTTTGGAAACATGACAAGGGTGTATTACAAAGAAGCCGTAGG
ATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGTCT
CTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAAAA
CCAATCCCATGTTTATTATTAGCTAACAAATGTGATCAACCGAAAGAAGG
GTTAGTCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGT
TCATTGGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAA
GCTTCGAAATTCCTTGTTCAAAAGATTCTAGAGAACGATCGAGCCAACAA
TCTGACAAGTCCAGACATCGATGATGATAAAATTGACCTGAGGAAGAAGC
CTGTTGATGTCGTCACGCAGCAAGAACGCTCGGGCTGCTGCTAAGTAATC
TATACTAGACAGTTAGCGTCCGTCCCTGGTAAGAGGGAATCCGGTTCTGT
TATAATTTTTAGATAAATTCATTTTGTAgataataaaaaagtatttcagC
AATTATATAATTTTAAGATGATCCGTACTTTTTAGAATAATAGAGGATAT
GTTCATGGGGTGGaaacttcttcatttttaaaaacattttgacccTAAAT
ATTGAAGttgcttaaccctttaagtgccgatgtcgtatatatacgacatg
ggctatataggagggcgaagccctcctgtaatgcccagtttgagttagaa
atcgtt
Run BLAST on NCBI

transcript from alignment at sc0000001:359692..371121+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000016 ID=TCONS_00000016|Name=TCONS_00000016|organism=Clytia hemisphaerica|type=transcript|length=11430bp|location=Sequence derived from alignment at sc0000001:359692..371121+ (Clytia hemisphaerica)
aaattttttaaagttctcagaagactccagtggtgtatatcatgaataga ttttaAAAATCCCAATCAGCCTAAAGTAGAAATTTGTCTCGTTTATTGTA TTTTCTTATCATCTAGCAGATTATTCAATcaataataatttttaaaaaga tcATGGAAAAGAAAGAACATTTGTACAAGATTTTGGTCATTGGAGACTTG GGAACAGGAAAGACCAGTATAATCAAACGTTATGTTCACAATTTCTTCTC AGTTCACTACAGGGCAACTGTAAGTTCATTTCATTCTGTTTAATTTTGGA TATATACATTatataaaggaagaaattttggcgggaagaaaatttgacGG ATTTGGATTTGGTGGATTTTGTCGAaacccgccaaattaagttccagCCA AAAGTTACTTTTTCCACCATccatcaaattaaattcctgccaaatttaaG TCTTCTCATTTTTTCGTTTCGATTTTTCACTATTTAGGCCCTAAATGGga gtattttcaacattttcacaCTGATTGTAAACCTTGAAACTCATTAATTT CATTGCCAATCCGCTAAACTAAATttcctctaaaaaactttttcggtcat ccgccaaattaaattccggccaaaatttcttcctttaatatACTTTCctt aataaatttatttttgctgttaATTGGAACAACTTGGGAAAGAACAGATT AACTTTcgaaagatttgaattttttataaatcaaaataaTGAGTGAATTT CAAAGACCTTTTTGTAGAGCAAAATTCCTCCACCTTTCCTGATTGTGATA GAGGAATCTCTAGAAACATAGTGGCCCTACCTGTCCTACCCTTTAATTTC CACTGGAGCAAAGAAAATATGAGGGGTTTTGTATAATTGGTcgaaaatga tcagaaaacattAATTCAACTTTTAAGAAATTCAACTCAAAGAAGGTTTT TAAGATGTTGACAGTGTCGAAATAGTCTAATTTAAAGAatttatattcaa aacaaaaacttggTTCAATAAAAATGGTGTACATAGGATTTCCGAGTCCT CCATCCAAACTTACTAAATTTCATGATCAAATGAgtaaataaaacaaata tacaggtacgagccgggaagtatcttatccatttggtggactaactttct tggggtttttcttgttccttatggtaataagaatattttaagcttctggg ccacctggatttctcacctgggtatccataatggcggatttttggtcatg tgacccccgtacgcaaaactgaaaattcgtccaacccaaatataggcata tcatatatcaatcgatcggaaatttgatactgattaattttgagatgcaa agttgggtctgaaaactttcctatctcgagatataaatcactttcgtttt ctcaggtttggctgcagttgtaggcTTTCATGGAGTtaggcaattctttt agtcatatctcaagaaatatgctttaaaacatatcaaaactttatgtgct cctagaaaaggcattaaaaattgtttatgcaaattttcaaaaattttgca gaaaaaatgtGTATTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNcataaaattttgatgaaattagtcTGGCTTTGAGA CCACTAAGCCATGATAGCTTTGTATGCGCCAGACGTCagactttgaatta ttttcctaaaaaagaacaaagtcccaaagtttttatttcttgcaaGCTTG CTAGACACTAGCACAGATTTGTCGCACAGTCACTGAACGGGCCTGTAGAG TTTCTGTCCACCCTACGACcatcacatggtatgggttggcCCTAGCAAAG TAgcatttacttttcattaaCTGAAACACAGCACCGAGTTGGAGTTAGTC CTGATCTCCTAGACAACGGTCAATACTACTACTGCGCCTTCACATGGGAT AAATCataactggacgtctatcttccattgtgtctttgaagcgagcttcg ttgccgcctgtattattaaattggtataaaaaagcCGTTGATATTCCGTC ACAATGCTATTTCGTTGAATTacttaggtaaaatgattgatagatagCTT GATAGTTTGAAAATCTATACTGTATATTAATatgctaaaacgtgtgtgtt tacaacgttttataaaaagttttcgaaaatctaacaaagctctacaaagc ctcctcttcatggcgttgaacttttttctcctttcttttataaaatcaaa atcttatcatCAATCAGCAGCTATCTTTCTTCCGTTGGGTATTTTTTTTA TGTATAGTGATttgctggattgggacacgcagcgtgcgacgctgcgcata cggctagttacTCTCAAGTCACaaaatgattattttcaattttttttata cgcNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN agaattttaaaatcaagatttcttaatattatacttagatttttgtaaga aaacggGGATATTTTGGACATGTAGCTTAAAGCATTATTTTATATGGCAA CAACTTCTTTAAAGCGCTTTAAGTTAAAACTCCTACAGTCTGACTTCTTC AACTAGCTGAAGGCTTTGTGTTGCACTCATGTAGTTAAAGCGGATATACA ATGATGCATTGGATTCATTATACGCCTCTTATAATTGTAACAGTAACCAG AATAGCCCCAAGCAGGTTCACAAATATGGCTCCATCACTAGGCTTCCTAC AATGGCCTTGGATTATCGCCTCTCGAAGCCATATTATGCCAACGTTTTTT GGTCCTACAGACAACACagattctaagccctctaaatctcgTTTCATGCA TGAACAATGAAGATAAAGGAATTGGCGAANNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNccagaagcttaaaatattcttattaccataag gaacaagaaaaaccccaagaaagttagtccaccaaatggataagatactt cccggctcgtacctgtATAAAAGGGTAGACGAGTGCAGAATGAACTTGGA CAAACTTAGTCCActataaaaataatctttaacatAACCAGCTCCTAGAA TAAGTACTAGTAAATAACACTACGTTcaggctattttgaaatgttttcaa ggGGCTATTATTCCCAAAATCATCCAAACGACCATGTTACTCCTCGTTAA TTTTTATGGACAAATTAAAATTCAGCCACTCCTCCTTGTAACTTATTTTG TTCAcatatcttttttaattttcctttttatttttgtcactTAAATAGAA GTCGAATGACAActaataaatcaaaatattctaaTTGCACAACTGTGAAA TCaattagtttttgaaaaaggtcataaagatttttatttttctcttttcg cgGGGTGATTACAGCAGGTTTATTACGGATTAATCACCCTGCTCCTCCCT TACATTTCTAAGCTAAAATGTAATCAGCCATATGATTACATGAAAAGAGT CACACTTACATTTTGAGAATTAATTGATGAAGGCTAAAATAGCTTCACTT GTCTACTTGTCTACTTATATGTTTACGAAGTAACTTCGACCTCTATATAT ACTAGGTCACTACTAAAATAAATCTTAATTGCCTGATTACATAATTAGGG TTGGGGTTAATGTCGTTAGCTATAGCATTTCAAAATAGTCGTAAAATAAA ACTTAAGGAAGACTTAACAGGAAGTACTCAAATAGGGAATTTGAAAGTAA TTAAAGGGGTAATGACAGTTAGCTTTCTGAGGAGCAAATATAATTTGATA TTGACTTTAATCATGCGAAAATGGGGATAAATGGCTTCCTGAGATTGTGA AACCTCGATTGTATTCACGAATCCAAGAGTTAACTTGGGGTTGCGCtcag aatttcaattttttaatttccatCTCTTTCCATCACTCTTTATGAGTATA TATaaacagatttaaaaaatatatttacagtTAACTTGTTGaggatttaa aggttttatttttacataagtgttcccgtttatATCAGACGCATATTtaa tatcaggacagtgtctgcctattgttttATTATGCTTATATAtccggggg ggtacttaggcaaaatgggtgctgggtatgtgcgaacCATAAAGGTTCCT TTTTCACACTCCCGAAAGCCTCTCAAAGGAGTCGTGATTtccaaaatttg aacaaaagtcaagtgaaaatcgacaaaaattttgagaaaagtctctctaa gggtcccaaaaaacgcCAACTTTTcttctctctaagggtcgattttcgat ttttggctcgtcAACTGGCAAACCTACATATAAtataaacctttttcatt tttctctcaGATTGGTGTTGATTTTGCTTTGAAAGTGTTGAATTGGGATG ACAAAACATTGATACGTCTACAGCTATGGGATATAGCaggtgaaactttt ttttttattgaaccaaaataaaaaaatgaagatacGACTTTTGCAAAAAT AGATTCTGTCACATTTGCAAAAcgcgctttttttataagaatacacttta taagaatgtccatgataaaaatagccaaaaaagctaagaatatcaccatc atggagtTTTGCTACTCAaactaagaatgccatttttagagtacTTTCAA TTATAAGTcgccccaagtaaggctcactccttcacaaaaatgccattatA TGCTTGAGGCGTACGTACTAAAtattaaatctagtctgaattaggatcct aacctaagatgcggtaagaatattttaggatgattttcccaaaaaagtta aaactattcatgatgaaatggatttacaccattcttataaaaaaagcgtt tacCACACAAGTCATCttttcattttaagaaaatacTAGTAACAATTTCT ACGTGGTTCTAccactacagggtgtccctaattaaagtatcgagtttgaa catgcgattgagtagaaaagtttgtgtgtgttatcgctaaaatataagaa cgttctccatcacacaggcttattaNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaaaggtagttacaa cgtataaattaatcgtaatgacaaagaaaaaagagggagagcttaaaata caattttgtgaacacgcacataaaactttctactcataaattgtgtttcg actcgatactttaattagggacaccctgtatttacCTTTTAATTAGTTCT ACGAAATAGAATTGGTTgtaaattatattttcattatttttgtttcaaat tcttTAGGACAAGAACGTTTTGGAAACATGACAAGGGTAATGATCGTTTG AATTATTCTAGAGATCGTcctatcattatttttttaacccTTACTGAAGT TATCAAAGTAGTGAAAATAGGGTACACGCCTTATAATGCCTCAATGTCAC CAtagaaataagaacatgataagaacaattttaggctcaaagtgccaaaa aaataagaacagatgAGCTTCTTAAAAGATTTGCTGGGTCTTATGTAAAA AATGCACAAtggaatctccataactcgagcaTGCAAGCGGGGGATACAAA TTTATTCGAGTTTAGGAAATcccgagttatggagtaaggtttataagaca GTGTTAACTTTAGGGAGAATAAACTTGTTCGAGTGTAGGAGACGTTGGAG TTAGAGGTTTGATAAAATCAATAAATCCACTGAATTTGATTTCTTGCTTC ACATGTGTATTACAAAGAAGCTGTGGGATGAAGACTTGTCTGAAATCTAG CGTCTCCGCTGCTTCTTGTTTACAtcaagggaactaattttcgcgggaac taatttttgttttttccgcGGTTTTTCAGCAACCCACAGAACCCACGAAT TACTAATTTAGCCATTCtatcaaaaaagttgaaaaatccctagaaatAAC GAAAAAAATGTGTCGAAAATATGGCAAAActtcgaaaattaattcccgcg agagacgattttttcgaattttttttctactgcaaaaattagttcctttt taaaaatttttatactTTCACATACACAGGTGTATTACAAAGAAGCCGTA GGATGTTTCATCGTGTTCGATGTAACGAGACAATCAACATTCGAAGCAGT CTCTAAATGGAAGAACGATCTCGATACTAAAGTTCAACTTCCTGATGGAA AACCAATCCCATGTTTATTATTAGCTAACAAAGTAAGTTTAGTTTTACTC CTGACTaaagtaacctgataacagattgtatattttctggcccagtacgc tgaagctctaaagacgtgggcgaaaatatagtttttagcgatctttagag cttcagggTGCTGTCGCGTTAAGAAAACTCCACAGTTGTTATCAGGTTAG ACTACAGAGGAAAGCTAGTAGGTAGGCTTGGTTAGTGAAGAATGACTCGG TAAATTGCATACTTTTACTATACAAGTGTTTTTCCATTCATCATCGAAAT TCTTAACTTCTTGGGGAAATtcattctaaaatattcttacggtattctta ggtcaAGATCGAaattaaaaacttaaatttaacatgtaatacccacctga agcataaaatggcattttcgtATTGAGCCTTACTCGggaagggctactta gactacacattATATTGGTGATCAATATTCAACAAAATTgcttgcggacc gtaatgtacgaagtaaccAACAGttgctctattataaaaaggagttttct ttctgtaaacaatccccctatattgttggcaaatcgagctgacaatatat tgcggacaacttttcaatatattgccagcATTCAACAATATATTCTCAAT ATATTGcccgacaatatattgtgtagtgtatgtagccctttaggTTCTGT TCAAATTTCattataaatattcttatagagtatAATTTGTAGCTAGAAAT GTGTTATCCCTTTCCAGTGAAGGGATACGCCGATAAAGTGATCATTCTCC TTCAGTTAATTTAACCAACACTGGGCTTAATCCACCACAGTTATCTTTTT TCTAGGTAGATTTTTTGGATGATAATTTTCTAGAAGAAAAATTAATATGA AGCATCACACGAACAAAGCATGTATGAACAGACTGAAAACTTATATAAGA AGCCATCTGTTTCATTTCTCTTTAGTGTGATCAACCGAAAGAAGGGTTAG TCAATAAGCCATCAGATATGGATAAATTTTGTGAAGAGAAAGGGTTCATT GGTTGGTACGAGACAAGTGCCAAAGAAAACATAAATATCGATGAAGCTTC GAAATTCCTTGTTCAAAAGGTAGGTATCAAAGTTGTTTAAGATATTGTTG GCAAATTCCCTAAAACCATTATTGTtagctacaatcaaggtcattatatt tgagaaaaagggtaattcctacgaaatcttaCAGCCACAAACGATTTGAA AGCGCTCTGATTTATTTTCGCAGGGTAGAGTCTTAAccctgagttttaac actagacttaacaACATCCAAATAGTTCAAGATTGGTCCAATacggctca gaatatagcctgaaagTCTATGAACCCCTCCCTAATTGAAAATTTCGATT ACATTTTACAAATAGCCCCAAAGTGACTTTCTGGCCCGAAGCGaagaaat aaccaaaattctcaatatgtTTTGACgatacagtgccgtaggaagcattt tcatattgggggggctgaagtttagtgacactgcgagggccaaccatggt ttggcccgagggggaaaatttttaaaatttttgtaaaacatgAAGCTGAG CTGAATAGGACTGAACATTCCGAGATTATCTTtagacatttttgtgaaat tcttaAAGACATACACTGACTGATTTTTTATCTTACCACTCTACCAAAGC TTGCCGAAGTTAGATATGAGATAGTAGAttgcacttttttttataagaac aaattatataagaacataaggctttggtggccaaaatcttaagaacaaat taagaatattttaaggctttgtgttCTTTAAAACACCTGTTTtgttagga aaatggacaaaaatactcaaaaataacatgctaaaaacatttttaggctt gaaacccgaAAAGCTAAGAGCATCTGaaggattcaaaaattttggatatt cttataaaaaaacgtgtattatttgatttctattatTCTGTTTCGTAGAT TCTAGAGAACGATCGAGCCAACAATCTGACAAGTCCAGACATCGATGATG ATAAAATTGACCTGAGGAAGAAGCCTGTTGATGTCGTCACGCAGCAAGAA CGCTCGGGCTGCTGCTAAGTAATCTATACTAGACAGTTAGCGTCCGTCCC TGGTAAGAGGGAATCCGGTTCTGTTATAATTTTTAGATAAATTCATTTTG TAgataataaaaaagtatttcagCAATTATATAATTTTAAGATGATCCGT ACTTTTTAGAATAATAGAGGATATGTTCATGGGGTGGaaacttcttcatt tttaaaaacattttgacccTAAATATTGAAGttgcttaaccctttaagtg ccgatgtcgtatatatacgacatgggctatataggagggcgaagccctcc tgtaatgcccagtttgagttagaaatcgtt
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000009XLOC_000009Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000016-exon-sc0000001-1491911889:359692..359960TCONS_00000016-exon-sc0000001-1491911889:359692..359960Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1510915933:359692..359960TCONS_00000016-exon-sc0000001-1510915933:359692..359960Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1491911889:366852..366930TCONS_00000016-exon-sc0000001-1491911889:366852..366930Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1510915933:366852..366930TCONS_00000016-exon-sc0000001-1510915933:366852..366930Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1491911889:367799..367827TCONS_00000016-exon-sc0000001-1491911889:367799..367827Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1510915933:367799..367827TCONS_00000016-exon-sc0000001-1510915933:367799..367827Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1491911889:368571..368723TCONS_00000016-exon-sc0000001-1491911889:368571..368723Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1510915933:368571..368723TCONS_00000016-exon-sc0000001-1510915933:368571..368723Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1491911889:369667..369810TCONS_00000016-exon-sc0000001-1491911889:369667..369810Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1510915933:369667..369810TCONS_00000016-exon-sc0000001-1510915933:369667..369810Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1491911889:370690..371121TCONS_00000016-exon-sc0000001-1491911889:370690..371121Clytia hemisphaericaexon
TCONS_00000016-exon-sc0000001-1510915933:370690..371121TCONS_00000016-exon-sc0000001-1510915933:370690..371121Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:359692..371121 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0.070585 2.36925 0.415568 0.356085 10.1466 7.10887 10.3336 12.6039 16.3751 18.9045 17.5081 13.0456 26.7218 24.8333 35.4506 31.2534 36.1017 38.7715 35.0943 46.0775 24.1216 20.9396 16.381 20.676 48.353 49.1731 28.6051 20.5084 28.9448 22.0891
Blast
BLAST of TCONS_00000016 vs. Swiss-Prot (Human)
Match: RAB32 (Ras-related protein Rab-32 OS=Homo sapiens GN=RAB32 PE=1 SV=3)

HSP 1 Score: 284.263 bits (726), Expect = 4.695e-94
Identity = 130/176 (73.86%), Postives = 154/176 (87.50%), Query Frame = 3
Query:  168 HLYKILVIGDLGTGKTSIIKRYVHNFFSVHYRATIGVDFALKVLNWDDKTLIRLQLWDIAGQERFGNMTRVYYKEAVGCFIVFDVTRQSTFEAVSKWKNDLDTKVQLPDGKPIPCLLLANKCDQPKEGLVNKPSDMDKFCEEKGFIGWYETSAKENINIDEASKFLVQKILENDRA 695
            HL+K+LVIG+LG GKTSIIKRYVH  FS HYRATIGVDFALKVLNWD +TL+RLQLWDIAGQERFGNMTRVYYKEAVG F+VFD++R STFEAV KWK+DLD+KV LP+G PIP +LLANKCDQ K+     PS +D+FC+E GF GW+ETSAK+NINI+EA++FLV+KIL N ++
Sbjct:   24 HLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDS-SQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQS 198          
The following BLAST results are available for this feature:
BLAST of TCONS_00000016 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
RAB324.695e-9473.86Ras-related protein Rab-32 OS=Homo sapiens GN=RAB3... [more]
back to top