TCONS_00000008 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000008
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2981

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000008 ID=TCONS_00000008|Name=|organism=Clytia hemisphaerica|type=transcript|length=2981bp
TCTTCAACAACCAATAAAACATGTCTCAGAATGGAGTCATCCAACCACTA
CTTACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataa
aaaaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTT
TCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTAT
GTGAAGAACTTCAAGTTTAGTGAAGATGatattgAATACTTGGTAAAAGT
GATGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatctaa
cCACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCTTT
GCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCT
TTTAGAGACAACACTTTTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAA
CTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGTTA
GAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGcttc
aaaatattgttatttGGGAGGTTTTGATGGAACAAGTGATGTTTTAGCTG
CCAAGAAATTCAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTT
TCGTCCTTCCATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAA
TAAAAACAGCCAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAAC
TACAAGAAGTTGCtgatattttcaagatttctaaGgatCAAGTGAATCAA
GGTGAATTGATGGCATTCACGGCTTACGCAAGTTCATTCCCAAGTTACTT
CCTAGCTTTGATTGATACTTATGATACATTGAAatCTGGTTGTATCAATT
TTTTAGCAGTTGTATTAGCATTAAAAGATTTTGGTTATCAATCTATTGGT
GTACGAATAGATTCTGGTGATTTAGCTTATTTATCAAAGGAATTACGGAA
AATGTTCACAAAGCTTTCAGAAAGCTTGAACATTGACTGGATAGCAAATT
TATCGATCACAGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTG
GAACAACAGGGACACAGTATCAATGCATTTGGAATCGGGACACATTTAGT
AACATGTCAGAAGCAACCAGCACTAGGATGTGTCTTCAAGCTTGTTGAGC
TAAATGGAGATCCAAGAATGAAGCTAAGTCAAGACATAGCAAAAGTCACA
ATTCcaggaaagaaaaacatttatcGATTGTATGGACATGATGGATTGGC
TTTGCTTGACCTTTTAACAAAAGCAGATGAAAAGGCTCCAGGTATCGAGG
AAAGAGTTTTATGCCAGCATCCAATACAAGGTGCTAAACGAGCATATGTC
AAACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTACTGGAAGAATGGAAA
GATTGAAACACCATTAGATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAA
AATCGTTAGCCACAATCAGACAGGACCACAAGCGTGCTCTCAACCCGACT
CCTTACAAGGTTTCAGTGACCACAGAGTTATTCCAATTTATGCATAATTT
ATGGATGGACTGTGCACCAATCAGCGAATTATCATAgattaaaacctttt
tttaaaggtgTTGAGTACCAGACCATTTCGAACATAGTTAGTAATGATAC
TCTTCCTCTTCTTTACACCTTTATCAGTCATACAAGTATAATTCGAATTC
CCCTTTCTTAAGGGAGAAGGGGCATATTATCGAAGAAAGGGGAATTCCGG
AATTTTCCTCAAAAGGAATGGGATAGCAAGAAGGGGGTCTACATAATTAg
ctttcaaatttcttttatattcaCTGTATTAGTCTAAAAACCATGTTAAA
GGTTAAGAACAAAACTATTAAGGGATTTTAGGGTCCTAGCTAAGATGGGT
AAAAAGGGACGTTTTCAAAGCACTTTTCAAGGTTGGGGATACCAAATGGG
TCATTCAGAAGGATTGTCAGACCCCTTCCACCCTATTACAAGGATAATGG
GTCTGACGGAGAGTCTTCAAAGAGCATTATCCTGAACAAAATACAGAATT
ATTTTCCCTTCACCTTTATATGCTACTAATTCACAAAGTTCTCCCAACGT
TCATATTTCGTTGTATTGTGTTAGCTGTTTAATAAATACTTCTTATAAAA
TTACACAAATACCCCCAGTACAATCGATATCTTGGTATATTTTAGATAGA
TTTATATACACATTATCTTTTGTTTTTGGAACACAGTTTTAAATGTCTTC
gaccaaaatttcgaaaaatgtaaaaaattttatCTACATAGTTAACTCAA
ATAAGAGTTCAGGCCAGTAATcttaaaataaattataaataaGATTTTAA
ATCTAGCTTTTTTCCAAATTATCGAAACCAtattgtaaattattttttta
aaggtattttttttacttttttttctgaTTCGTTCTGTTTTGTAATACTT
ATTCCCATATAACTTTGAAGAGAGGGAGTCTAGGGCTTATCCCACATTAA
AGGTGAACNTGTAAAAATTTTTATCTACATAGTTAACTCAAATAAGAGTT
CAGGTCAGTAATcttaaaataaattataaattatttttttataggtattt
ttttttacttttttttctgaTTCGTTCTGTTTTGTAATACTTATTCCCAT
ATAACTTTGAAGAGAGGGGAGTCTAGGGCTTATCCCACATTAAAGGTgaa
cattttgtttttgtatttatatGATACGATTTCTTTTTACAACACTCGAT
ATCAACTTAATTTCTtgtacatttttaattttagttattatatttaattt
tttgataattatGATTATTGGTTATCAATGTTaaagatctttttgaaatt
atctttAGAATTGttataaaatatagaaaattttGTCTTTACGGTGTTTC
ATTTCTTATTTCCAGGGATCTGATTTGTGAA
Run BLAST on NCBI

protein sequence of TCONS_00000008-protein

>TCONS_00000008-protein ID=TCONS_00000008-protein|Name=TCONS_00000008-protein|organism=Clytia hemisphaerica|type=polypeptide|length=538bp
MSQNGVIQPLLTDFYQISMAYAYWDNKKMNDHAVFDLFFRKNPFKGEFTI
FAGLSECINYVKNFKFSEDDIEYLVKVMPESTDPEFFTFLKNLTTNEVTI
SAIPEGTVVFAKVPLIRVEGPLAVVQLLETTLLNLVNFASLVATNAARFR
HASGEDKLLLEFGLRRAQGPDGGLSASKYCYLGGFDGTSDVLAAKKFNIP
VKGTHAHAFVSSFHKADDVSQFHKLLNKNSQQNESLLPTVEKKLQEVADI
FKISKDQVNQGELMAFTAYASSFPSYFLALIDTYDTLKSGCINFLAVVLA
LKDFGYQSIGVRIDSGDLAYLSKELRKMFTKLSESLNIDWIANLSITASN
DINEETLYSLEQQGHSINAFGIGTHLVTCQKQPALGCVFKLVELNGDPRM
KLSQDIAKVTIPGKKNIYRLYGHDGLALLDLLTKADEKAPGIEERVLCQH
PIQGAKRAYVKPKVIESLLKVYWKNGKIETPLDDLEGCRQVVKKSLATIR
QDHKRALNPTPYKVSVTTELFQFMHNLWMDCAPISELS
Run BLAST on NCBI

transcript from alignment at sc0000001:135795..144660+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000008 ID=TCONS_00000008|Name=TCONS_00000008|organism=Clytia hemisphaerica|type=transcript|length=8866bp|location=Sequence derived from alignment at sc0000001:135795..144660+ (Clytia hemisphaerica)
TCTTCAACAACCAATAAAACATGTCTCAGAATGGAGTCATCCAACCACTA CTTACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataa aaaaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTT TCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTAT GTGAAGAACTTCAAGTTTAGTGAAGATGGTAAgtgatattttcagatttt tagattttttttttgagatgcTTTGCAAAAAAGCTGAGAATCTTTATTAA GAACAGGAGCTTTTTGACTTTAAATCTTTTCCAATGTTCTTTTAATTAGG ATGATGAAAccttttttctcatttcattttttcatttcttccaaTTTTTT CTTGACCAAATTTTTTGCTTTCCAGCTCTATCATGCAAGGTTGGTTATCA TTAGTGTtcttacttaattttttttttcagatattgAATACTTGGTAAAA GTGATGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatct aacCACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCT TTGCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGGTATCATT CATAATCTTGTTTATTTATCAATTATTTCAGTAATGATTAGGTTTGGTTG AGCTTAATAATGTATTTAATTAcgttatttatttttgatacaATTAATGT TCCATAACCATATGTAATTAAACAAGAACTTGATTTTCTAAACTAAGCTA ATTTTCTTTCAGTTGTCCAGCTTTTAGAGACAACACTTTTGAATTTGGTC AATTTTGCAAGGTATGTAGGAGTTTACATTTCATTACTAGCTTAAAATAT GATGGAACTTCATGTCATTTAAAGATATTCATTTATATGAAGTGATTGTT AGCCATCACACTTGTTAATAACAATATCCAGTCAATAAGTTATCGTACAA AACTGACaacaaaaaaaatgttccaTCCTTATTAAATCAGCTGGCCTAAT CTGATATAACCCTAGAAAATCAATATGCTATTTCTTACATGGGGTTATAT AATATTGTCCTGTttactttctgattttttgtatttttcagtcTTGTGGC AACTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGT TAGAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGct tcaaaatattgttatttGGGAGGTAAAGTTATTTATTGCTGATATTCctg atttcaatagaaattaaTAACACTTTTATAAGATATAAACAGTGTAAGTG Gcagggggggtcagtactaaaatgtaagacatacatgagtactaaaagga ttttcgctaatttttgacatacccccacctatttttcgaaaATGTTATTT TAGTACACATGTACTAAAATTATTTTGAGCAATTTAAtatagataccacc cattttttgccctgTTACagctttaaatttaccaaaatggggtcattgtt acaaacctagtcgaatttagtgcatcaatctgcaaaaaaatataatttta ttactaaactgtgctgaactgtacataaaaatatttttaaaaaatattta aagaattggaaaaattctgaaagatttctgaagatttttttgaaaattcc tgaaaaaaaaaatcaaatttttccaaaatttttaaaaaaatgctccattt tggctgattttagaacaaaatactaagatttttcaaaaatttctttaagg gaccaccctttttggtattttagtacacatNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNCAGTGTAGGTGGAACTTCCAGATTCCAGGATTA CAGTTTTACCaactttttagcaatttttgccctGTTGACCCAAATcccgc aacctctttaccttaaggaagtttttcagcgttccgaaaaaaaatgcatg gccaatttttttctcatcttcacaggatcaatTCTCAACCAAAGAATaca tcttttgtgaaaaatttatcTGCCTTTTTGCAGAGCAGAGCAAAAGAGCA AAACTTTTTGCCGTTgaacttttttaaacaaataagCATGGACATTGCCT TCAGACTGGATTTTGGCTAAGCACTCACTTTTCACCTATATGCTTACTTA TCGTTAACAGGTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATT CAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCC ATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGC CAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGT TGCtgatattttcaagatttctaaGGTACTGCCAAGTGCAAAGCAAAATA CAGGCTGTCtggaaaatgagaaaatgaaaCATGTTTAAAGGGTAACaaac actacacaatatattgttaggcaatatattgaaaaggtgtcctcaatata ttgtcagcttgatttgcaattttctcaaaaatatagggggattgtttaca gaaagaaaattcctttttataatagagcaccTGAAAAcgatattgtcgaa tattgcttgtcaatatattgtgtagtctaagtagcccttatgTAAAGCTA TTGTGTGCACTTTGTATCATTGTTTAATATATACACAAGAAAGTTTTCCA ATATAACCATGTACTGCTAAAAAAGAATAGatgacatttttattttgtag gatCAAGTGAATCAAGGTGAATTGATGGCATTCACGGCTTACGCAAGTTC ATTCCCAAGTTACTTCCTAGCTTTGATTGATACTTATGATACATTGAAGT AAGggattttctatttttgtactttttttttaaattttcaactttttgtt ttgaaggaCGATTTTAATCACaaagaattgtttttgttttattttttcat cttttagatCTGGTTGTATCAATTTTTTAGCAGTTGTATTAGCATTAAAA GATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTGGTGATTTAGC TTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTTTCAGAAAGGT AAGTGTAAATAAAATCCAACagctttttcaaaactttccaTCTTCTGGAC TTAAGAATACTCAAAAAGAATACGCATCCAAAAGGTTAATGTCATTTTAA CCTTGAAAGATATCATTCTTCTCTATGACTCTGTTGAAAAGTCTTGATGA TTATATACAAACTTTGTTTGAAAGTAATTCAGAATCTTGATTGGTGCAAC CACCTAACTCTTCAACAGATCATGTTCTCAGAAGATTTTTTCGATCTGAG CCAGCAGATTGTTTTCTTTCTAAGCTTACTGTTTCCGTACAAAACATGAA ATTGTTTCGGATATCTGCTGGCCCAGACAGGGCAAGAGATTGAGGTACCC AGGTGTTTGTTTCCAACTTAGGTCCTTTGTGACCTAGATTAAAGGATTAC GATGAAGTGTGTTcacaattgatttttataaatttattcATTTCCTATAA ATGATTTTTATCATTAGAATAAATTTCCTTTATTAGCTTGAATTTTTGGC TGGAAAGCAAATTTAGCAATCACAGCAATTAATATTTatcatcaaaatga aattccTCTATTAGCTTGAACATTGACTGGATAGCAAATTTATCGATCAC AGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGG TTTTTTTACTCACCATTTTGAAAGGGAGAATGTTTTATATTATCATTGTT GTGATAACTTTTACAACCCTTTTTtgccattttgttttcaattaggAAAA TAACTCATATTTTTTTGACAACTAATCAGCtaatgttgcttgttttttct gatttttgcagtaagctgcgtattcgcaatgctcaaaacatggctgagtt tgatttttgagaaaaaagtttttccggttgaagatgccggaaatcgccgt ttttgcaaattttcattggattttttccttatatttctatgtttttcaca caaaaacattattgataacaatgctcaccatcaagcatgattcaattgtN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaagcatgattcaattg tcaataaaactgatttttgcgactagaactttctatttattttttcccta caacccttccctctcccccccatcaacaatcaatgacaaatttattgcat tatgcatttttgctaaacgctatattttctgactgattgctatctaactt tcatcatcaggtaggtccattcagcatcgaGTTTATTTAAATGGAAACTC TTCAAATGAAATTACAATATTTCCTGTTAAATCATAGTCCAGGCACACGG CAGCGGGGGGCTAGTGTCAGTATATTGtggccctatcactttcaagTGGA GCCGTGGCCCCTGTTGTCAACTCAAAGTTATCTCTTTTTCAGGGACACAG TATCAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAAC CAGCACTAGGATGTGTCTTCAAGGTATAATTACATATTAGCAAGGGATGT AATTGTCAATGTCTCTGTGTATTAATTGAAATGTAACAGCTTCTTAGAAG CTTCTTTGAATATAATATATAGCATTGTAGAAAATCTTGACGTAAAAAAT CTtgtttgccaataaaaaagacTAGCACAGGGATTCCATTTAATCATTGA TCTATTATACAGGCGGAACATATacatttgtttttattaaattgtctttt ttttgaCGTAATTCACAATGTCCATATCAGTTTCTTGATGATATCTCGAG ATTAGGTTATGTTAAATTATTGGCGAAGCACTTTTTGCTGCCTAGAAAAA CATTAATGTAGCCTTAGCTTAACTCCCCCGAGTCATTTTAAAGAaccttt tcctgaaaaatttgattgttCTATCTGCTGTTTTGCATTTATTTATAACA atactttatagttttgaaagtctAGTTGTGGACCAATTTtcttgggacga gatggagtttttacaagctcttatttgatttggttggtcctTAAccatta acaaaacaattttgttattttttctaaagaatgcatcatttttattactt caaattaCCAATTATTAATGTGTCATGTAAAAACTCTATCTCATCTGATA TTCTTGGTCACATGAAGTAACAGAGTTTTTTTAACCTTCTTGTGTCTCAA AAATATGATGGATTTTAATGAAtaattaaaaagctttattttttatattt gttgtCTTTTTGCAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCT AAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaaacatttatc GATTGTATGGACATGATGGTAGGATGTTTAAGTTTTTATCCTCTATTCCT ATAACACCGTGTCTTAAAGTGATTGTGACAGGGTCAACGTTCAGAATCAT TAGGTTGAATTAGTTTTCCCTCAAAATCCTGTCACTTTGGCTAAGAAGAC CAATTTAAAAGTCCACAGTGACCTTAGATTTACAGTAGCTTTCTAAAGTA TTACGAAAGATTATTGGTGGGTTTAAACATGTCACATTCTGTTTTAttat ccttattttttgttgtagGATTGGCTTTGCTTGACCTTTTAACAAAAGCA GATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAAT ACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTC TCAAAGTCTACTGGAAGAATGGAAAGGTACACTCATTTTTCTCACAGGGG GAATTTTTTGTGTCGTCAAAGGGTCagccactcttttttgcctcaAATTT TATGATTGTGTTATGATTATgtaatgttttttgaataatagTTTTGAAAT CTTTAAGGTTTAGAATATCCCAATACTTTATGTATTCCCAAGATTGAGCC TACTGTATTTTTAGCTCTTTATGCCGGCTAGTTACTTAACTAGTTTCACT ACCAATTCTTTGGACTTATGAGTGCAACAAATGGAAAGGAAAAGCAATAA AGACCAAAAGGCAATAgatgaaaagtttttcaataaagGAAAACTCTACt atacaaaaatacaaaggtggtttcccttgaaaaatacaaaaaataaaaag tgattttccttgagaaatacaagcaatgaaaaatgatttaGATTGAAAAA ATGTAATAACTGAAAAGagattttccttgagaaatacaagaaatcgaaaa ttttgcCAATAAATGAAAAGTGGTTTTCCTAGAGAAATACAGAAATTTTC AAGTATTTGTGAAATACAAGCAATGAAATGATTTGCCTTGAAAaaatata ctaaatgaaaagggattttccttgagaaatacaaataatgaaaattgatt CTAATTGAGAAATAGGGAGAAAAAAACATAATTCATCCAGAAatacaaaa catgaaaaaaaaaataataaaattatgAATAATGATCGACTTTGTGTATG ATCATAATTTTATAGATTGAAACACCATTAGATGACTTAGAGGGTTGTCG CCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGCGTG CTCTCAACCCGACTCCTTACAAGGTAAGTCTTTTCAGCCTTCTCAAACAT TTCTTCAATCATAATACATGAAAATGACCAGGTAAAGGATCTGCATATTA AAGTAAGCAGCAGTAACATGAAGGTGCATTATCCACTTATGTTGTGCAAG GTTGCATGTttaacccccagccgggtcatccAAAGATTCACAAAATGGTA CTGGATGCCACTCTGCTTGATGTGGGCATCTGAAGAGACATCACTTGTAA GtagagaaatccagggaaaggattGGCAACCTCCCCTATCTTCAGGTAGA CATctagagaaaagggagcctcCGGGTCAACCTCCACTGCGGTCACAAAC TTATTTATAATAGTTAAAGTTTTGGTATAAGGGTATACATGATTTGGTAC TTCTAATACTGTAGACAGACATAATATTTTAATCCCTTAGTTAACGTTGA CCCATCATTAAACCATCATTATTCATCCATCTTCTTACTTATAGGTTTCA GTGACCACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGC ACCAATCAGCGAATTATCATAgattaaaacctttttttaaaggtgTTGAG TACCAGACCATTTCGAACATAGTTAGTAATGATACTCTTCCTCTTCTTTA CACCTTTATCAGTCATACAAGTATAATTCGAATTCCCCTTTCTTAAGGGA GAAGGGGCATATTATCGAAGAAAGGGGAATTCCGGAATTTTCCTCAAAAG GAATGGGATAGCAAGAAGGGGGTCTACATAATTAgctttcaaatttcttt tatattcaCTGTATTAGTCTAAAAACCATGTTAAAGGTTAAGAACAAAAC TATTAAGGGATTTTAGGGTCCTAGCTAAGATGGGTAAAAAGGGACGTTTT CAAAGCACTTTTCAAGGTTGGGGATACCAAATGGGTCATTCAGAAGGATT GTCAGACCCCTTCCACCCTATTACAAGGATAATGGGTCTGACGGAGAGTC TTCAAAGAGCATTATCCTGAACAAAATACAGAATTATTTTCCCTTCACCT TTATATGCTACTAATTCACAAAGTTCTCCCAACGTTCATATTTCGTTGTA TTGTGTTAGCTGTTTAATAAATACTTCTTATAAAATTACACAAATACCCC CAGTACAATCGATATCTTGGTATATTTTAGATAGATTTATATACACATTA TCTTTTGTTTTTGGAACACAGTTTTAAATGTCTTCgaccaaaatttcgaa aaatgtaaaaaattttatCTACATAGTTAACTCAAATAAGAGTTCAGGCC AGTAATcttaaaataaattataaataaGATTTTAAATCTAGCTTTTTTCC AAATTATCGAAACCAtattgtaaattatttttttaaaggtatttttttta cttttttttctgaTTCGTTCTGTTTTGTAATACTTATTCCCATATAACTT TGAAGAGAGGGAGTCTAGGGCTTATCCCACATTAAAGGTGAACNTGTAAA AATTTTTATCTACATAGTTAACTCAAATAAGAGTTCAGGTCAGTAATctt aaaataaattataaattatttttttataggtatttttttttacttttttt tctgaTTCGTTCTGTTTTGTAATACTTATTCCCATATAACTTTGAAGAGA GGGGAGTCTAGGGCTTATCCCACATTAAAGGTgaacattttgtttttgta tttatatGATACGATTTCTTTTTACAACACTCGATATCAACTTAATTTCT tgtacatttttaattttagttattatatttaattttttgataattatGAT TATTGGTTATCAATGTTaaagatctttttgaaattatctttAGAATTGtt ataaaatatagaaaattttGTCTTTACGGTGTTTCATTTCTTATTTCCAG GGATCTGATTTGTGAA

Coding sequence (CDS) from alignment at sc0000001:135795..144660+

>TCONS_00000008 ID=TCONS_00000008|Name=|organism=Clytia hemisphaerica|type=CDS|length=21021bp|location=Sequence derived from alignment at sc0000001:135795..144660+ (Clytia hemisphaerica)
ATGTCTCAGAATGGAGTCATCCAACCACTACTTACTGACTTTTACCAAAT
ATCCATGGCATATGCATATTGggataataaaaaaatgaatgacCATGCCG
TTTTTGATTTGTTCTTTCGTAAGAACCCTTTCAAAGGAGAGTTCACAATT
TTTGCTGGATTAAGCGAGTGCATTAATTATGTGAAGAACTTCAAGTTTAG
TGAAGATGatattgAATACTTGGTAAAAGTGATGCCAGAATCAACTGATC
CagaattttttactttcttgaaaaatctaacCACAAATGAAGTCACTATT
AGTGCGATTCCAGAAGGAACTGTTGTCTTTGCTAAAGTTCCTCTTATAAG
AGTTGAGGGACCTCTAGCAGTTGTCCAGCTTTTAGAGACAACACTTTTGA
ATTTGGTCAATTTTGCAAGtcTTGTGGCAACTAATGCTGCAAGGTTCAGA
CACGCTTCAGGAGAAGATAAACTACTGTTAGAATTTGGTTTACGAAGAGC
TCAAGGCCCTGATGGTGGATTATCTGcttcaaaatattgttatttGGGAG
GTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATTCAATATTCCA
GTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCCATAAAGCAGA
TGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGCCAGCAAAATG
AATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGTTGCtgatatt
ttcaagatttctaaGgatCAAGTGAATCAAGGTGAATTGATGGCATTCAC
GGCTTACGCAAGTTCATTCCCAAGTTACTTCCTAGCTTTGATTGATACTT
ATGATACATTGAAatCTGGTTGTATCAATTTTTTAGCAGTTGTATTAGCA
TTAAAAGATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTGGTGA
TTTAGCTTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTTTCAG
AAAGCTTGAACATTGACTGGATAGCAAATTTATCGATCACAGCAAGCAAT
GATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGGGACACAGTAT
CAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAACCAG
CACTAGGATGTGTCTTCAAGCTTGTTGAGCTAAATGGAGATCCAAGAATG
AAGCTAAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaaacat
ttatcGATTGTATGGACATGATGGATTGGCTTTGCTTGACCTTTTAACAA
AAGCAGATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCAT
CCAATACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTGAAAG
TCTTCTCAAAGTCTACTGGAAGAATGGAAAGATTGAAACACCATTAGATG
ACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAATCGTTAGCCACAATCAGA
CAGGACCACAAGCGTGCTCTCAACCCGACTCCTTACAAGGTTTCAGTGAC
CACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGCACCAA
TCAGCGAATTATCATAgATGTCTCAGAATGGAGTCATCCAACCACTACTT
ACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataaaaa
aatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTTTCA
AAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTATGTG
AAGAACTTCAAGTTTAGTGAAGATGatattgAATACTTGGTAAAAGTGAT
GCCAGAATCAACTGATCCagaattttttactttcttgaaaaatctaacCA
CAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCTTTGCT
AAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCTTTT
AGAGACAACACTTTTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAACTA
ATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGTTAGAA
TTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGcttcaaa
atattgttatttGGGAGGTTTTGATGGAACAAGTGATGTTTTAGCTGCCA
AGAAATTCAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTTTCG
TCCTTCCATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAATAA
AAACAGCCAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAACTAC
AAGAAGTTGCtgatattttcaagatttctaaGgatCAAGTGAATCAAGGT
GAATTGATGGCATTCACGGCTTACGCAAGTTCATTCCCAAGTTACTTCCT
AGCTTTGATTGATACTTATGATACATTGAAatCTGGTTGTATCAATTTTT
TAGCAGTTGTATTAGCATTAAAAGATTTTGGTTATCAATCTATTGGTGTA
CGAATAGATTCTGGTGATTTAGCTTATTTATCAAAGGAATTACGGAAAAT
GTTCACAAAGCTTTCAGAAAGCTTGAACATTGACTGGATAGCAAATTTAT
CGATCACAGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTGGAA
CAACAGGGACACAGTATCAATGCATTTGGAATCGGGACACATTTAGTAAC
ATGTCAGAAGCAACCAGCACTAGGATGTGTCTTCAAGCTTGTTGAGCTAA
ATGGAGATCCAAGAATGAAGCTAAGTCAAGACATAGCAAAAGTCACAATT
CcaggaaagaaaaacatttatcGATTGTATGGACATGATGGATTGGCTTT
GCTTGACCTTTTAACAAAAGCAGATGAAAAGGCTCCAGGTATCGAGGAAA
GAGTTTTATGCCAGCATCCAATACAAGGTGCTAAACGAGCATATGTCAAA
CCAAAAGTTATTGAAAGTCTTCTCAAAGTCTACTGGAAGAATGGAAAGAT
TGAAACACCATTAGATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAAT
CGTTAGCCACAATCAGACAGGACCACAAGCGTGCTCTCAACCCGACTCCT
TACAAGGTTTCAGTGACCACAGAGTTATTCCAATTTATGCATAATTTATG
GATGGACTGTGCACCAATCAGCGAATTATCATAgATGTCTCAGAATGGAG
TCATCCAACCACTACTTACTGACTTTTACCAAATATCCATGGCATATGCA
TATTGggataataaaaaaatgaatgacCATGCCGTTTTTGATTTGTTCTT
TCGTAAGAACCCTTTCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCG
AGTGCATTAATTATGTGAAGAACTTCAAGTTTAGTGAAGATGatattgAA
TACTTGGTAAAAGTGATGCCAGAATCAACTGATCCagaattttttacttt
cttgaaaaatctaacCACAAATGAAGTCACTATTAGTGCGATTCCAGAAG
GAACTGTTGTCTTTGCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTA
GCAGTTGTCCAGCTTTTAGAGACAACACTTTTGAATTTGGTCAATTTTGC
AAGtcTTGTGGCAACTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAG
ATAAACTACTGTTAGAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGT
GGATTATCTGcttcaaaatattgttatttGGGAGGTTTTGATGGAACAAG
TGATGTTTTAGCTGCCAAGAAATTCAATATTCCAGTAAAAGGGACCCATG
CACATGCATTTGTTTCGTCCTTCCATAAAGCAGATGATGTCAGTCAGTTT
CATAAACTGCTGAATAAAAACAGCCAGCAAAATGAATCTCTACTTCCTAC
TGTTGAGAAAAAACTACAAGAAGTTGCtgatattttcaagatttctaaGg
atCAAGTGAATCAAGGTGAATTGATGGCATTCACGGCTTACGCAAGTTCA
TTCCCAAGTTACTTCCTAGCTTTGATTGATACTTATGATACATTGAAatC
TGGTTGTATCAATTTTTTAGCAGTTGTATTAGCATTAAAAGATTTTGGTT
ATCAATCTATTGGTGTACGAATAGATTCTGGTGATTTAGCTTATTTATCA
AAGGAATTACGGAAAATGTTCACAAAGCTTTCAGAAAGCTTGAACATTGA
CTGGATAGCAAATTTATCGATCACAGCAAGCAATGATATCAATGAGGAGA
CACTTTACTCTTTGGAACAACAGGGACACAGTATCAATGCATTTGGAATC
GGGACACATTTAGTAACATGTCAGAAGCAACCAGCACTAGGATGTGTCTT
CAAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCTAAGTCAAGACA
TAGCAAAAGTCACAATTCcaggaaagaaaaacatttatcGATTGTATGGA
CATGATGGATTGGCTTTGCTTGACCTTTTAACAAAAGCAGATGAAAAGGC
TCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAATACAAGGTGCTA
AACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTAC
TGGAAGAATGGAAAGATTGAAACACCATTAGATGACTTAGAGGGTTGTCG
CCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGCGTG
CTCTCAACCCGACTCCTTACAAGGTTTCAGTGACCACAGAGTTATTCCAA
TTTATGCATAATTTATGGATGGACTGTGCACCAATCAGCGAATTATCATA
gATGTCTCAGAATGGAGTCATCCAACCACTACTTACTGACTTTTACCAAA
TATCCATGGCATATGCATATTGggataataaaaaaatgaatgacCATGCC
GTTTTTGATTTGTTCTTTCGTAAGAACCCTTTCAAAGGAGAGTTCACAAT
TTTTGCTGGATTAAGCGAGTGCATTAATTATGTGAAGAACTTCAAGTTTA
GTGAAGATGatattgAATACTTGGTAAAAGTGATGCCAGAATCAACTGAT
CCagaattttttactttcttgaaaaatctaacCACAAATGAAGTCACTAT
TAGTGCGATTCCAGAAGGAACTGTTGTCTTTGCTAAAGTTCCTCTTATAA
GAGTTGAGGGACCTCTAGCAGTTGTCCAGCTTTTAGAGACAACACTTTTG
AATTTGGTCAATTTTGCAAGtcTTGTGGCAACTAATGCTGCAAGGTTCAG
ACACGCTTCAGGAGAAGATAAACTACTGTTAGAATTTGGTTTACGAAGAG
CTCAAGGCCCTGATGGTGGATTATCTGcttcaaaatattgttatttGGGA
GGTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATTCAATATTCC
AGTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCCATAAAGCAG
ATGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGCCAGCAAAAT
GAATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGTTGCtgatat
tttcaagatttctaaGgatCAAGTGAATCAAGGTGAATTGATGGCATTCA
CGGCTTACGCAAGTTCATTCCCAAGTTACTTCCTAGCTTTGATTGATACT
TATGATACATTGAAatCTGGTTGTATCAATTTTTTAGCAGTTGTATTAGC
ATTAAAAGATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTGGTG
ATTTAGCTTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTTTCA
GAAAGCTTGAACATTGACTGGATAGCAAATTTATCGATCACAGCAAGCAA
TGATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGGGACACAGTA
TCAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAACCA
GCACTAGGATGTGTCTTCAAGCTTGTTGAGCTAAATGGAGATCCAAGAAT
GAAGCTAAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaaaca
tttatcGATTGTATGGACATGATGGATTGGCTTTGCTTGACCTTTTAACA
AAAGCAGATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCA
TCCAATACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTGAAA
GTCTTCTCAAAGTCTACTGGAAGAATGGAAAGATTGAAACACCATTAGAT
GACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAATCGTTAGCCACAATCAG
ACAGGACCACAAGCGTGCTCTCAACCCGACTCCTTACAAGGTTTCAGTGA
CCACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGCACCA
ATCAGCGAATTATCATAgATGTCTCAGAATGGAGTCATCCAACCACTACT
TACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataaaa
aaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTTTC
AAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTATGT
GAAGAACTTCAAGTTTAGTGAAGATGatattgAATACTTGGTAAAAGTGA
TGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatctaacC
ACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCTTTGC
TAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCTTT
TAGAGACAACACTTTTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAACT
AATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGTTAGA
ATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGcttcaa
aatattgttatttGGGAGGTTTTGATGGAACAAGTGATGTTTTAGCTGCC
AAGAAATTCAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTTTC
GTCCTTCCATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAATA
AAAACAGCCAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAACTA
CAAGAAGTTGCtgatattttcaagatttctaaGgatCAAGTGAATCAAGG
TGAATTGATGGCATTCACGGCTTACGCAAGTTCATTCCCAAGTTACTTCC
TAGCTTTGATTGATACTTATGATACATTGAAatCTGGTTGTATCAATTTT
TTAGCAGTTGTATTAGCATTAAAAGATTTTGGTTATCAATCTATTGGTGT
ACGAATAGATTCTGGTGATTTAGCTTATTTATCAAAGGAATTACGGAAAA
TGTTCACAAAGCTTTCAGAAAGCTTGAACATTGACTGGATAGCAAATTTA
TCGATCACAGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTGGA
ACAACAGGGACACAGTATCAATGCATTTGGAATCGGGACACATTTAGTAA
CATGTCAGAAGCAACCAGCACTAGGATGTGTCTTCAAGCTTGTTGAGCTA
AATGGAGATCCAAGAATGAAGCTAAGTCAAGACATAGCAAAAGTCACAAT
TCcaggaaagaaaaacatttatcGATTGTATGGACATGATGGATTGGCTT
TGCTTGACCTTTTAACAAAAGCAGATGAAAAGGCTCCAGGTATCGAGGAA
AGAGTTTTATGCCAGCATCCAATACAAGGTGCTAAACGAGCATATGTCAA
ACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTACTGGAAGAATGGAAAGA
TTGAAACACCATTAGATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAA
TCGTTAGCCACAATCAGACAGGACCACAAGCGTGCTCTCAACCCGACTCC
TTACAAGGTTTCAGTGACCACAGAGTTATTCCAATTTATGCATAATTTAT
GGATGGACTGTGCACCAATCAGCGAATTATCATAgATGTCTCAGAATGGA
GTCATCCAACCACTACTTACTGACTTTTACCAAATATCCATGGCATATGC
ATATTGggataataaaaaaatgaatgacCATGCCGTTTTTGATTTGTTCT
TTCGTAAGAACCCTTTCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGC
GAGTGCATTAATTATGTGAAGAACTTCAAGTTTAGTGAAGATGatattgA
ATACTTGGTAAAAGTGATGCCAGAATCAACTGATCCagaattttttactt
tcttgaaaaatctaacCACAAATGAAGTCACTATTAGTGCGATTCCAGAA
GGAACTGTTGTCTTTGCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCT
AGCAGTTGTCCAGCTTTTAGAGACAACACTTTTGAATTTGGTCAATTTTG
CAAGtcTTGTGGCAACTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAA
GATAAACTACTGTTAGAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGG
TGGATTATCTGcttcaaaatattgttatttGGGAGGTTTTGATGGAACAA
GTGATGTTTTAGCTGCCAAGAAATTCAATATTCCAGTAAAAGGGACCCAT
GCACATGCATTTGTTTCGTCCTTCCATAAAGCAGATGATGTCAGTCAGTT
TCATAAACTGCTGAATAAAAACAGCCAGCAAAATGAATCTCTACTTCCTA
CTGTTGAGAAAAAACTACAAGAAGTTGCtgatattttcaagatttctaaG
gatCAAGTGAATCAAGGTGAATTGATGGCATTCACGGCTTACGCAAGTTC
ATTCCCAAGTTACTTCCTAGCTTTGATTGATACTTATGATACATTGAAat
CTGGTTGTATCAATTTTTTAGCAGTTGTATTAGCATTAAAAGATTTTGGT
TATCAATCTATTGGTGTACGAATAGATTCTGGTGATTTAGCTTATTTATC
AAAGGAATTACGGAAAATGTTCACAAAGCTTTCAGAAAGCTTGAACATTG
ACTGGATAGCAAATTTATCGATCACAGCAAGCAATGATATCAATGAGGAG
ACACTTTACTCTTTGGAACAACAGGGACACAGTATCAATGCATTTGGAAT
CGGGACACATTTAGTAACATGTCAGAAGCAACCAGCACTAGGATGTGTCT
TCAAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCTAAGTCAAGAC
ATAGCAAAAGTCACAATTCcaggaaagaaaaacatttatcGATTGTATGG
ACATGATGGATTGGCTTTGCTTGACCTTTTAACAAAAGCAGATGAAAAGG
CTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAATACAAGGTGCT
AAACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTA
CTGGAAGAATGGAAAGATTGAAACACCATTAGATGACTTAGAGGGTTGTC
GCCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGCGT
GCTCTCAACCCGACTCCTTACAAGGTTTCAGTGACCACAGAGTTATTCCA
ATTTATGCATAATTTATGGATGGACTGTGCACCAATCAGCGAATTATCAT
AgATGTCTCAGAATGGAGTCATCCAACCACTACTTACTGACTTTTACCAA
ATATCCATGGCATATGCATATTGggataataaaaaaatgaatgacCATGC
CGTTTTTGATTTGTTCTTTCGTAAGAACCCTTTCAAAGGAGAGTTCACAA
TTTTTGCTGGATTAAGCGAGTGCATTAATTATGTGAAGAACTTCAAGTTT
AGTGAAGATGatattgAATACTTGGTAAAAGTGATGCCAGAATCAACTGA
TCCagaattttttactttcttgaaaaatctaacCACAAATGAAGTCACTA
TTAGTGCGATTCCAGAAGGAACTGTTGTCTTTGCTAAAGTTCCTCTTATA
AGAGTTGAGGGACCTCTAGCAGTTGTCCAGCTTTTAGAGACAACACTTTT
GAATTTGGTCAATTTTGCAAGtcTTGTGGCAACTAATGCTGCAAGGTTCA
GACACGCTTCAGGAGAAGATAAACTACTGTTAGAATTTGGTTTACGAAGA
GCTCAAGGCCCTGATGGTGGATTATCTGcttcaaaatattgttatttGGG
AGGTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATTCAATATTC
CAGTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCCATAAAGCA
GATGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGCCAGCAAAA
TGAATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGTTGCtgata
ttttcaagatttctaaGgatCAAGTGAATCAAGGTGAATTGATGGCATTC
ACGGCTTACGCAAGTTCATTCCCAAGTTACTTCCTAGCTTTGATTGATAC
TTATGATACATTGAAatCTGGTTGTATCAATTTTTTAGCAGTTGTATTAG
CATTAAAAGATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTGGT
GATTTAGCTTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTTTC
AGAAAGCTTGAACATTGACTGGATAGCAAATTTATCGATCACAGCAAGCA
ATGATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGGGACACAGT
ATCAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAACC
AGCACTAGGATGTGTCTTCAAGCTTGTTGAGCTAAATGGAGATCCAAGAA
TGAAGCTAAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaaac
atttatcGATTGTATGGACATGATGGATTGGCTTTGCTTGACCTTTTAAC
AAAAGCAGATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGC
ATCCAATACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTGAA
AGTCTTCTCAAAGTCTACTGGAAGAATGGAAAGATTGAAACACCATTAGA
TGACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAATCGTTAGCCACAATCA
GACAGGACCACAAGCGTGCTCTCAACCCGACTCCTTACAAGGTTTCAGTG
ACCACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGCACC
AATCAGCGAATTATCATAgATGTCTCAGAATGGAGTCATCCAACCACTAC
TTACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataaa
aaaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTTT
CAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTATG
TGAAGAACTTCAAGTTTAGTGAAGATGatattgAATACTTGGTAAAAGTG
ATGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatctaac
CACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCTTTG
CTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCTT
TTAGAGACAACACTTTTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAAC
TAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGTTAG
AATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGcttca
aaatattgttatttGGGAGGTTTTGATGGAACAAGTGATGTTTTAGCTGC
CAAGAAATTCAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTTT
CGTCCTTCCATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAAT
AAAAACAGCCAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAACT
ACAAGAAGTTGCtgatattttcaagatttctaaGgatCAAGTGAATCAAG
GTGAATTGATGGCATTCACGGCTTACGCAAGTTCATTCCCAAGTTACTTC
CTAGCTTTGATTGATACTTATGATACATTGAAatCTGGTTGTATCAATTT
TTTAGCAGTTGTATTAGCATTAAAAGATTTTGGTTATCAATCTATTGGTG
TACGAATAGATTCTGGTGATTTAGCTTATTTATCAAAGGAATTACGGAAA
ATGTTCACAAAGCTTTCAGAAAGCTTGAACATTGACTGGATAGCAAATTT
ATCGATCACAGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTGG
AACAACAGGGACACAGTATCAATGCATTTGGAATCGGGACACATTTAGTA
ACATGTCAGAAGCAACCAGCACTAGGATGTGTCTTCAAGCTTGTTGAGCT
AAATGGAGATCCAAGAATGAAGCTAAGTCAAGACATAGCAAAAGTCACAA
TTCcaggaaagaaaaacatttatcGATTGTATGGACATGATGGATTGGCT
TTGCTTGACCTTTTAACAAAAGCAGATGAAAAGGCTCCAGGTATCGAGGA
AAGAGTTTTATGCCAGCATCCAATACAAGGTGCTAAACGAGCATATGTCA
AACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTACTGGAAGAATGGAAAG
ATTGAAACACCATTAGATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAAA
ATCGTTAGCCACAATCAGACAGGACCACAAGCGTGCTCTCAACCCGACTC
CTTACAAGGTTTCAGTGACCACAGAGTTATTCCAATTTATGCATAATTTA
TGGATGGACTGTGCACCAATCAGCGAATTATCATAgATGTCTCAGAATGG
AGTCATCCAACCACTACTTACTGACTTTTACCAAATATCCATGGCATATG
CATATTGggataataaaaaaatgaatgacCATGCCGTTTTTGATTTGTTC
TTTCGTAAGAACCCTTTCAAAGGAGAGTTCACAATTTTTGCTGGATTAAG
CGAGTGCATTAATTATGTGAAGAACTTCAAGTTTAGTGAAGATGatattg
AATACTTGGTAAAAGTGATGCCAGAATCAACTGATCCagaattttttact
ttcttgaaaaatctaacCACAAATGAAGTCACTATTAGTGCGATTCCAGA
AGGAACTGTTGTCTTTGCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTC
TAGCAGTTGTCCAGCTTTTAGAGACAACACTTTTGAATTTGGTCAATTTT
GCAAGtcTTGTGGCAACTAATGCTGCAAGGTTCAGACACGCTTCAGGAGA
AGATAAACTACTGTTAGAATTTGGTTTACGAAGAGCTCAAGGCCCTGATG
GTGGATTATCTGcttcaaaatattgttatttGGGAGGTTTTGATGGAACA
AGTGATGTTTTAGCTGCCAAGAAATTCAATATTCCAGTAAAAGGGACCCA
TGCACATGCATTTGTTTCGTCCTTCCATAAAGCAGATGATGTCAGTCAGT
TTCATAAACTGCTGAATAAAAACAGCCAGCAAAATGAATCTCTACTTCCT
ACTGTTGAGAAAAAACTACAAGAAGTTGCtgatattttcaagatttctaa
GgatCAAGTGAATCAAGGTGAATTGATGGCATTCACGGCTTACGCAAGTT
CATTCCCAAGTTACTTCCTAGCTTTGATTGATACTTATGATACATTGAAa
tCTGGTTGTATCAATTTTTTAGCAGTTGTATTAGCATTAAAAGATTTTGG
TTATCAATCTATTGGTGTACGAATAGATTCTGGTGATTTAGCTTATTTAT
CAAAGGAATTACGGAAAATGTTCACAAAGCTTTCAGAAAGCTTGAACATT
GACTGGATAGCAAATTTATCGATCACAGCAAGCAATGATATCAATGAGGA
GACACTTTACTCTTTGGAACAACAGGGACACAGTATCAATGCATTTGGAA
TCGGGACACATTTAGTAACATGTCAGAAGCAACCAGCACTAGGATGTGTC
TTCAAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCTAAGTCAAGA
CATAGCAAAAGTCACAATTCcaggaaagaaaaacatttatcGATTGTATG
GACATGATGGATTGGCTTTGCTTGACCTTTTAACAAAAGCAGATGAAAAG
GCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAATACAAGGTGC
TAAACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTCTCAAAGTCT
ACTGGAAGAATGGAAAGATTGAAACACCATTAGATGACTTAGAGGGTTGT
CGCCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGCG
TGCTCTCAACCCGACTCCTTACAAGGTTTCAGTGACCACAGAGTTATTCC
AATTTATGCATAATTTATGGATGGACTGTGCACCAATCAGCGAATTATCA
TAgATGTCTCAGAATGGAGTCATCCAACCACTACTTACTGACTTTTACCA
AATATCCATGGCATATGCATATTGggataataaaaaaatgaatgacCATG
CCGTTTTTGATTTGTTCTTTCGTAAGAACCCTTTCAAAGGAGAGTTCACA
ATTTTTGCTGGATTAAGCGAGTGCATTAATTATGTGAAGAACTTCAAGTT
TAGTGAAGATGatattgAATACTTGGTAAAAGTGATGCCAGAATCAACTG
ATCCagaattttttactttcttgaaaaatctaacCACAAATGAAGTCACT
ATTAGTGCGATTCCAGAAGGAACTGTTGTCTTTGCTAAAGTTCCTCTTAT
AAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCTTTTAGAGACAACACTTT
TGAATTTGGTCAATTTTGCAAGtcTTGTGGCAACTAATGCTGCAAGGTTC
AGACACGCTTCAGGAGAAGATAAACTACTGTTAGAATTTGGTTTACGAAG
AGCTCAAGGCCCTGATGGTGGATTATCTGcttcaaaatattgttatttGG
GAGGTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATTCAATATT
CCAGTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCCATAAAGC
AGATGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGCCAGCAAA
ATGAATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGTTGCtgat
attttcaagatttctaaGgatCAAGTGAATCAAGGTGAATTGATGGCATT
CACGGCTTACGCAAGTTCATTCCCAAGTTACTTCCTAGCTTTGATTGATA
CTTATGATACATTGAAatCTGGTTGTATCAATTTTTTAGCAGTTGTATTA
GCATTAAAAGATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTGG
TGATTTAGCTTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTTT
CAGAAAGCTTGAACATTGACTGGATAGCAAATTTATCGATCACAGCAAGC
AATGATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGGGACACAG
TATCAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAAC
CAGCACTAGGATGTGTCTTCAAGCTTGTTGAGCTAAATGGAGATCCAAGA
ATGAAGCTAAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaaa
catttatcGATTGTATGGACATGATGGATTGGCTTTGCTTGACCTTTTAA
CAAAAGCAGATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAG
CATCCAATACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTGA
AAGTCTTCTCAAAGTCTACTGGAAGAATGGAAAGATTGAAACACCATTAG
ATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAATCGTTAGCCACAATC
AGACAGGACCACAAGCGTGCTCTCAACCCGACTCCTTACAAGGTTTCAGT
GACCACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGCAC
CAATCAGCGAATTATCATAgATGTCTCAGAATGGAGTCATCCAACCACTA
CTTACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataa
aaaaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTT
TCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTAT
GTGAAGAACTTCAAGTTTAGTGAAGATGatattgAATACTTGGTAAAAGT
GATGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatctaa
cCACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCTTT
GCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCT
TTTAGAGACAACACTTTTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAA
CTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGTTA
GAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGcttc
aaaatattgttatttGGGAGGTTTTGATGGAACAAGTGATGTTTTAGCTG
CCAAGAAATTCAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTT
TCGTCCTTCCATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAA
TAAAAACAGCCAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAAC
TACAAGAAGTTGCtgatattttcaagatttctaaGgatCAAGTGAATCAA
GGTGAATTGATGGCATTCACGGCTTACGCAAGTTCATTCCCAAGTTACTT
CCTAGCTTTGATTGATACTTATGATACATTGAAatCTGGTTGTATCAATT
TTTTAGCAGTTGTATTAGCATTAAAAGATTTTGGTTATCAATCTATTGGT
GTACGAATAGATTCTGGTGATTTAGCTTATTTATCAAAGGAATTACGGAA
AATGTTCACAAAGCTTTCAGAAAGCTTGAACATTGACTGGATAGCAAATT
TATCGATCACAGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTG
GAACAACAGGGACACAGTATCAATGCATTTGGAATCGGGACACATTTAGT
AACATGTCAGAAGCAACCAGCACTAGGATGTGTCTTCAAGCTTGTTGAGC
TAAATGGAGATCCAAGAATGAAGCTAAGTCAAGACATAGCAAAAGTCACA
ATTCcaggaaagaaaaacatttatcGATTGTATGGACATGATGGATTGGC
TTTGCTTGACCTTTTAACAAAAGCAGATGAAAAGGCTCCAGGTATCGAGG
AAAGAGTTTTATGCCAGCATCCAATACAAGGTGCTAAACGAGCATATGTC
AAACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTACTGGAAGAATGGAAA
GATTGAAACACCATTAGATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAA
AATCGTTAGCCACAATCAGACAGGACCACAAGCGTGCTCTCAACCCGACT
CCTTACAAGGTTTCAGTGACCACAGAGTTATTCCAATTTATGCATAATTT
ATGGATGGACTGTGCACCAATCAGCGAATTATCATAgATGTCTCAGAATG
GAGTCATCCAACCACTACTTACTGACTTTTACCAAATATCCATGGCATAT
GCATATTGggataataaaaaaatgaatgacCATGCCGTTTTTGATTTGTT
CTTTCGTAAGAACCCTTTCAAAGGAGAGTTCACAATTTTTGCTGGATTAA
GCGAGTGCATTAATTATGTGAAGAACTTCAAGTTTAGTGAAGATGatatt
gAATACTTGGTAAAAGTGATGCCAGAATCAACTGATCCagaattttttac
tttcttgaaaaatctaacCACAAATGAAGTCACTATTAGTGCGATTCCAG
AAGGAACTGTTGTCTTTGCTAAAGTTCCTCTTATAAGAGTTGAGGGACCT
CTAGCAGTTGTCCAGCTTTTAGAGACAACACTTTTGAATTTGGTCAATTT
TGCAAGtcTTGTGGCAACTAATGCTGCAAGGTTCAGACACGCTTCAGGAG
AAGATAAACTACTGTTAGAATTTGGTTTACGAAGAGCTCAAGGCCCTGAT
GGTGGATTATCTGcttcaaaatattgttatttGGGAGGTTTTGATGGAAC
AAGTGATGTTTTAGCTGCCAAGAAATTCAATATTCCAGTAAAAGGGACCC
ATGCACATGCATTTGTTTCGTCCTTCCATAAAGCAGATGATGTCAGTCAG
TTTCATAAACTGCTGAATAAAAACAGCCAGCAAAATGAATCTCTACTTCC
TACTGTTGAGAAAAAACTACAAGAAGTTGCtgatattttcaagatttcta
aGgatCAAGTGAATCAAGGTGAATTGATGGCATTCACGGCTTACGCAAGT
TCATTCCCAAGTTACTTCCTAGCTTTGATTGATACTTATGATACATTGAA
atCTGGTTGTATCAATTTTTTAGCAGTTGTATTAGCATTAAAAGATTTTG
GTTATCAATCTATTGGTGTACGAATAGATTCTGGTGATTTAGCTTATTTA
TCAAAGGAATTACGGAAAATGTTCACAAAGCTTTCAGAAAGCTTGAACAT
TGACTGGATAGCAAATTTATCGATCACAGCAAGCAATGATATCAATGAGG
AGACACTTTACTCTTTGGAACAACAGGGACACAGTATCAATGCATTTGGA
ATCGGGACACATTTAGTAACATGTCAGAAGCAACCAGCACTAGGATGTGT
CTTCAAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCTAAGTCAAG
ACATAGCAAAAGTCACAATTCcaggaaagaaaaacatttatcGATTGTAT
GGACATGATGGATTGGCTTTGCTTGACCTTTTAACAAAAGCAGATGAAAA
GGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAATACAAGGTG
CTAAACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTCTCAAAGTC
TACTGGAAGAATGGAAAGATTGAAACACCATTAGATGACTTAGAGGGTTG
TCGCCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGC
GTGCTCTCAACCCGACTCCTTACAAGGTTTCAGTGACCACAGAGTTATTC
CAATTTATGCATAATTTATGGATGGACTGTGCACCAATCAGCGAATTATC
ATAgATGTCTCAGAATGGAGTCATCCAACCACTACTTACTGACTTTTACC
AAATATCCATGGCATATGCATATTGggataataaaaaaatgaatgacCAT
GCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTTTCAAAGGAGAGTTCAC
AATTTTTGCTGGATTAAGCGAGTGCATTAATTATGTGAAGAACTTCAAGT
TTAGTGAAGATGatattgAATACTTGGTAAAAGTGATGCCAGAATCAACT
GATCCagaattttttactttcttgaaaaatctaacCACAAATGAAGTCAC
TATTAGTGCGATTCCAGAAGGAACTGTTGTCTTTGCTAAAGTTCCTCTTA
TAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCTTTTAGAGACAACACTT
TTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAACTAATGCTGCAAGGTT
CAGACACGCTTCAGGAGAAGATAAACTACTGTTAGAATTTGGTTTACGAA
GAGCTCAAGGCCCTGATGGTGGATTATCTGcttcaaaatattgttatttG
GGAGGTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATTCAATAT
TCCAGTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCCATAAAG
CAGATGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGCCAGCAA
AATGAATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGTTGCtga
tattttcaagatttctaaGgatCAAGTGAATCAAGGTGAATTGATGGCAT
TCACGGCTTACGCAAGTTCATTCCCAAGTTACTTCCTAGCTTTGATTGAT
ACTTATGATACATTGAAatCTGGTTGTATCAATTTTTTAGCAGTTGTATT
AGCATTAAAAGATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTG
GTGATTTAGCTTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTT
TCAGAAAGCTTGAACATTGACTGGATAGCAAATTTATCGATCACAGCAAG
CAATGATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGGGACACA
GTATCAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAA
CCAGCACTAGGATGTGTCTTCAAGCTTGTTGAGCTAAATGGAGATCCAAG
AATGAAGCTAAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaa
acatttatcGATTGTATGGACATGATGGATTGGCTTTGCTTGACCTTTTA
ACAAAAGCAGATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCA
GCATCCAATACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTG
AAAGTCTTCTCAAAGTCTACTGGAAGAATGGAAAGATTGAAACACCATTA
GATGACTTAGAGGGTTGTCGCCAAGTTGTGAAAAAATCGTTAGCCACAAT
CAGACAGGACCACAAGCGTGCTCTCAACCCGACTCCTTACAAGGTTTCAG
TGACCACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGCA
CCAATCAGCGAATTATCATAg
Gene-mRNA-Prot