TCONS_00000007 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000007
Unique NameTCONS_00000007
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length2896

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000007 ID=TCONS_00000007|Name=TCONS_00000007|organism=Clytia hemisphaerica|type=transcript|length=2896bp
TCTTCAACAACCAATAAAACATGTCTCAGAATGGAGTCATCCAACCACTA
CTTACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataa
aaaaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTT
TCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTAT
GTGAAGAACTTCAAGTTTAGTGAAGATGatattgAATACTTGGTAAAAGT
GATGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatctaa
cCACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCTTT
GCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGTTGTCCAGCT
TTTAGAGACAACACTTTTGAATTTGGTCAATTTTGCAAGtcTTGTGGCAA
CTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGTTA
GAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGcttc
aaaatattgttatttGGGAGGTTTTGATGGAACAAGTGATGTTTTAGCTG
CCAAGAAATTCAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTT
TCGTCCTTCCATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAA
TAAAAACAGCCAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAAC
TACAAGAAGTTGCtgatattttcaagatttctaaGgatCAAGTGAATCAA
GGTGAATTGATGGCATTCACGGCTTACGCAAGTTCATTCCCAAGTTACTT
CCTAGCTTTGATTGATACTTATGATACATTGAAatCTGGTTGTATCAATT
TTTTAGCAGTTGTATTAGCATTAAAAGATTTTGGTTATCAATCTATTGGT
GTACGAATAGATTCTGGTGATTTAGCTTATTTATCAAAGGAATTACGGAA
AATGTTCACAAAGCTTTCAGAAAGGGACACAGTATCAATGCATTTGGAAT
CGGGACACATTTAGTAACATGTCAGAAGCAACCAGCACTAGGATGTGTCT
TCAAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCTAAGTCAAGAC
ATAGCAAAAGTCACAATTCcaggaaagaaaaacatttatcGATTGTATGG
ACATGATGGATTGGCTTTGCTTGACCTTTTAACAAAAGCAGATGAAAAGG
CTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAATACAAGGTGCT
AAACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTCTCAAAGTCTA
CTGGAAGAATGGAAAGATTGAAACACCATTAGATGACTTAGAGGGTTGTC
GCCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGCGT
GCTCTCAACCCGACTCCTTACAAGGTTTCAGTGACCACAGAGTTATTCCA
ATTTATGCATAATTTATGGATGGACTGTGCACCAATCAGCGAATTATCAT
AgattaaaacctttttttaaaggtgTTGAGTACCAGACCATTTCGAACAT
AGTTAGTAATGATACTCTTCCTCTTCTTTACACCTTTATCAGTCATACAA
GTATAATTCGAATTCCCCTTTCTTAAGGGAGAAGGGGCATATTATCGAAG
AAAGGGGAATTCCGGAATTTTCCTCAAAAGGAATGGGATAGCAAGAAGGG
GGTCTACATAATTAgctttcaaatttcttttatattcaCTGTATTAGTCT
AAAAACCATGTTAAAGGTTAAGAACAAAACTATTAAGGGATTTTAGGGTC
CTAGCTAAGATGGGTAAAAAGGGACGTTTTCAAAGCACTTTTCAAGGTTG
GGGATACCAAATGGGTCATTCAGAAGGATTGTCAGACCCCTTCCACCCTA
TTACAAGGATAATGGGTCTGACGGAGAGTCTTCAAAGAGCATTATCCTGA
ACAAAATACAGAATTATTTTCCCTTCACCTTTATATGCTACTAATTCACA
AAGTTCTCCCAACGTTCATATTTCGTTGTATTGTGTTAGCTGTTTAATAA
ATACTTCTTATAAAATTACACAAATACCCCCAGTACAATCGATATCTTGG
TATATTTTAGATAGATTTATATACACATTATCTTTTGTTTTTGGAACACA
GTTTTAAATGTCTTCgaccaaaatttcgaaaaatgtaaaaaattttatCT
ACATAGTTAACTCAAATAAGAGTTCAGGCCAGTAATcttaaaataaatta
taaataaGATTTTAAATCTAGCTTTTTTCCAAATTATCGAAACCAtattg
taaattatttttttaaaggtattttttttacttttttttctgaTTCGTTC
TGTTTTGTAATACTTATTCCCATATAACTTTGAAGAGAGGGAGTCTAGGG
CTTATCCCACATTAAAGGTGAACNTGTAAAAATTTTTATCTACATAGTTA
ACTCAAATAAGAGTTCAGGTCAGTAATcttaaaataaattataaattatt
tttttataggtatttttttttacttttttttctgaTTCGTTCTGTTTTGT
AATACTTATTCCCATATAACTTTGAAGAGAGGGGAGTCTAGGGCTTATCC
CACATTAAAGGTgaacattttgtttttgtatttatatGATACGATTTCTT
TTTACAACACTCGATATCAACTTAATTTCTtgtacatttttaattttagt
tattatatttaattttttgataattatGATTATTGGTTATCAATGTTaaa
gatctttttgaaattatctttAGAATTGttataaaatatagaaaattttG
TCTTTACGGTGTTTCATTTCTTATTTCCAGGGATCTGATTTGTGAA
Run BLAST on NCBI

transcript from alignment at sc0000001:135795..144660+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000007 ID=TCONS_00000007|Name=TCONS_00000007|organism=Clytia hemisphaerica|type=transcript|length=8866bp|location=Sequence derived from alignment at sc0000001:135795..144660+ (Clytia hemisphaerica)
TCTTCAACAACCAATAAAACATGTCTCAGAATGGAGTCATCCAACCACTA CTTACTGACTTTTACCAAATATCCATGGCATATGCATATTGggataataa aaaaatgaatgacCATGCCGTTTTTGATTTGTTCTTTCGTAAGAACCCTT TCAAAGGAGAGTTCACAATTTTTGCTGGATTAAGCGAGTGCATTAATTAT GTGAAGAACTTCAAGTTTAGTGAAGATGGTAAgtgatattttcagatttt tagattttttttttgagatgcTTTGCAAAAAAGCTGAGAATCTTTATTAA GAACAGGAGCTTTTTGACTTTAAATCTTTTCCAATGTTCTTTTAATTAGG ATGATGAAAccttttttctcatttcattttttcatttcttccaaTTTTTT CTTGACCAAATTTTTTGCTTTCCAGCTCTATCATGCAAGGTTGGTTATCA TTAGTGTtcttacttaattttttttttcagatattgAATACTTGGTAAAA GTGATGCCAGAATCAACTGATCCagaattttttactttcttgaaaaatct aacCACAAATGAAGTCACTATTAGTGCGATTCCAGAAGGAACTGTTGTCT TTGCTAAAGTTCCTCTTATAAGAGTTGAGGGACCTCTAGCAGGTATCATT CATAATCTTGTTTATTTATCAATTATTTCAGTAATGATTAGGTTTGGTTG AGCTTAATAATGTATTTAATTAcgttatttatttttgatacaATTAATGT TCCATAACCATATGTAATTAAACAAGAACTTGATTTTCTAAACTAAGCTA ATTTTCTTTCAGTTGTCCAGCTTTTAGAGACAACACTTTTGAATTTGGTC AATTTTGCAAGGTATGTAGGAGTTTACATTTCATTACTAGCTTAAAATAT GATGGAACTTCATGTCATTTAAAGATATTCATTTATATGAAGTGATTGTT AGCCATCACACTTGTTAATAACAATATCCAGTCAATAAGTTATCGTACAA AACTGACaacaaaaaaaatgttccaTCCTTATTAAATCAGCTGGCCTAAT CTGATATAACCCTAGAAAATCAATATGCTATTTCTTACATGGGGTTATAT AATATTGTCCTGTttactttctgattttttgtatttttcagtcTTGTGGC AACTAATGCTGCAAGGTTCAGACACGCTTCAGGAGAAGATAAACTACTGT TAGAATTTGGTTTACGAAGAGCTCAAGGCCCTGATGGTGGATTATCTGct tcaaaatattgttatttGGGAGGTAAAGTTATTTATTGCTGATATTCctg atttcaatagaaattaaTAACACTTTTATAAGATATAAACAGTGTAAGTG Gcagggggggtcagtactaaaatgtaagacatacatgagtactaaaagga ttttcgctaatttttgacatacccccacctatttttcgaaaATGTTATTT TAGTACACATGTACTAAAATTATTTTGAGCAATTTAAtatagataccacc cattttttgccctgTTACagctttaaatttaccaaaatggggtcattgtt acaaacctagtcgaatttagtgcatcaatctgcaaaaaaatataatttta ttactaaactgtgctgaactgtacataaaaatatttttaaaaaatattta aagaattggaaaaattctgaaagatttctgaagatttttttgaaaattcc tgaaaaaaaaaatcaaatttttccaaaatttttaaaaaaatgctccattt tggctgattttagaacaaaatactaagatttttcaaaaatttctttaagg gaccaccctttttggtattttagtacacatNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNCAGTGTAGGTGGAACTTCCAGATTCCAGGATTA CAGTTTTACCaactttttagcaatttttgccctGTTGACCCAAATcccgc aacctctttaccttaaggaagtttttcagcgttccgaaaaaaaatgcatg gccaatttttttctcatcttcacaggatcaatTCTCAACCAAAGAATaca tcttttgtgaaaaatttatcTGCCTTTTTGCAGAGCAGAGCAAAAGAGCA AAACTTTTTGCCGTTgaacttttttaaacaaataagCATGGACATTGCCT TCAGACTGGATTTTGGCTAAGCACTCACTTTTCACCTATATGCTTACTTA TCGTTAACAGGTTTTGATGGAACAAGTGATGTTTTAGCTGCCAAGAAATT CAATATTCCAGTAAAAGGGACCCATGCACATGCATTTGTTTCGTCCTTCC ATAAAGCAGATGATGTCAGTCAGTTTCATAAACTGCTGAATAAAAACAGC CAGCAAAATGAATCTCTACTTCCTACTGTTGAGAAAAAACTACAAGAAGT TGCtgatattttcaagatttctaaGGTACTGCCAAGTGCAAAGCAAAATA CAGGCTGTCtggaaaatgagaaaatgaaaCATGTTTAAAGGGTAACaaac actacacaatatattgttaggcaatatattgaaaaggtgtcctcaatata ttgtcagcttgatttgcaattttctcaaaaatatagggggattgtttaca gaaagaaaattcctttttataatagagcaccTGAAAAcgatattgtcgaa tattgcttgtcaatatattgtgtagtctaagtagcccttatgTAAAGCTA TTGTGTGCACTTTGTATCATTGTTTAATATATACACAAGAAAGTTTTCCA ATATAACCATGTACTGCTAAAAAAGAATAGatgacatttttattttgtag gatCAAGTGAATCAAGGTGAATTGATGGCATTCACGGCTTACGCAAGTTC ATTCCCAAGTTACTTCCTAGCTTTGATTGATACTTATGATACATTGAAGT AAGggattttctatttttgtactttttttttaaattttcaactttttgtt ttgaaggaCGATTTTAATCACaaagaattgtttttgttttattttttcat cttttagatCTGGTTGTATCAATTTTTTAGCAGTTGTATTAGCATTAAAA GATTTTGGTTATCAATCTATTGGTGTACGAATAGATTCTGGTGATTTAGC TTATTTATCAAAGGAATTACGGAAAATGTTCACAAAGCTTTCAGAAAGGT AAGTGTAAATAAAATCCAACagctttttcaaaactttccaTCTTCTGGAC TTAAGAATACTCAAAAAGAATACGCATCCAAAAGGTTAATGTCATTTTAA CCTTGAAAGATATCATTCTTCTCTATGACTCTGTTGAAAAGTCTTGATGA TTATATACAAACTTTGTTTGAAAGTAATTCAGAATCTTGATTGGTGCAAC CACCTAACTCTTCAACAGATCATGTTCTCAGAAGATTTTTTCGATCTGAG CCAGCAGATTGTTTTCTTTCTAAGCTTACTGTTTCCGTACAAAACATGAA ATTGTTTCGGATATCTGCTGGCCCAGACAGGGCAAGAGATTGAGGTACCC AGGTGTTTGTTTCCAACTTAGGTCCTTTGTGACCTAGATTAAAGGATTAC GATGAAGTGTGTTcacaattgatttttataaatttattcATTTCCTATAA ATGATTTTTATCATTAGAATAAATTTCCTTTATTAGCTTGAATTTTTGGC TGGAAAGCAAATTTAGCAATCACAGCAATTAATATTTatcatcaaaatga aattccTCTATTAGCTTGAACATTGACTGGATAGCAAATTTATCGATCAC AGCAAGCAATGATATCAATGAGGAGACACTTTACTCTTTGGAACAACAGG TTTTTTTACTCACCATTTTGAAAGGGAGAATGTTTTATATTATCATTGTT GTGATAACTTTTACAACCCTTTTTtgccattttgttttcaattaggAAAA TAACTCATATTTTTTTGACAACTAATCAGCtaatgttgcttgttttttct gatttttgcagtaagctgcgtattcgcaatgctcaaaacatggctgagtt tgatttttgagaaaaaagtttttccggttgaagatgccggaaatcgccgt ttttgcaaattttcattggattttttccttatatttctatgtttttcaca caaaaacattattgataacaatgctcaccatcaagcatgattcaattgtN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNaagcatgattcaattg tcaataaaactgatttttgcgactagaactttctatttattttttcccta caacccttccctctcccccccatcaacaatcaatgacaaatttattgcat tatgcatttttgctaaacgctatattttctgactgattgctatctaactt tcatcatcaggtaggtccattcagcatcgaGTTTATTTAAATGGAAACTC TTCAAATGAAATTACAATATTTCCTGTTAAATCATAGTCCAGGCACACGG CAGCGGGGGGCTAGTGTCAGTATATTGtggccctatcactttcaagTGGA GCCGTGGCCCCTGTTGTCAACTCAAAGTTATCTCTTTTTCAGGGACACAG TATCAATGCATTTGGAATCGGGACACATTTAGTAACATGTCAGAAGCAAC CAGCACTAGGATGTGTCTTCAAGGTATAATTACATATTAGCAAGGGATGT AATTGTCAATGTCTCTGTGTATTAATTGAAATGTAACAGCTTCTTAGAAG CTTCTTTGAATATAATATATAGCATTGTAGAAAATCTTGACGTAAAAAAT CTtgtttgccaataaaaaagacTAGCACAGGGATTCCATTTAATCATTGA TCTATTATACAGGCGGAACATATacatttgtttttattaaattgtctttt ttttgaCGTAATTCACAATGTCCATATCAGTTTCTTGATGATATCTCGAG ATTAGGTTATGTTAAATTATTGGCGAAGCACTTTTTGCTGCCTAGAAAAA CATTAATGTAGCCTTAGCTTAACTCCCCCGAGTCATTTTAAAGAaccttt tcctgaaaaatttgattgttCTATCTGCTGTTTTGCATTTATTTATAACA atactttatagttttgaaagtctAGTTGTGGACCAATTTtcttgggacga gatggagtttttacaagctcttatttgatttggttggtcctTAAccatta acaaaacaattttgttattttttctaaagaatgcatcatttttattactt caaattaCCAATTATTAATGTGTCATGTAAAAACTCTATCTCATCTGATA TTCTTGGTCACATGAAGTAACAGAGTTTTTTTAACCTTCTTGTGTCTCAA AAATATGATGGATTTTAATGAAtaattaaaaagctttattttttatattt gttgtCTTTTTGCAGCTTGTTGAGCTAAATGGAGATCCAAGAATGAAGCT AAGTCAAGACATAGCAAAAGTCACAATTCcaggaaagaaaaacatttatc GATTGTATGGACATGATGGTAGGATGTTTAAGTTTTTATCCTCTATTCCT ATAACACCGTGTCTTAAAGTGATTGTGACAGGGTCAACGTTCAGAATCAT TAGGTTGAATTAGTTTTCCCTCAAAATCCTGTCACTTTGGCTAAGAAGAC CAATTTAAAAGTCCACAGTGACCTTAGATTTACAGTAGCTTTCTAAAGTA TTACGAAAGATTATTGGTGGGTTTAAACATGTCACATTCTGTTTTAttat ccttattttttgttgtagGATTGGCTTTGCTTGACCTTTTAACAAAAGCA GATGAAAAGGCTCCAGGTATCGAGGAAAGAGTTTTATGCCAGCATCCAAT ACAAGGTGCTAAACGAGCATATGTCAAACCAAAAGTTATTGAAAGTCTTC TCAAAGTCTACTGGAAGAATGGAAAGGTACACTCATTTTTCTCACAGGGG GAATTTTTTGTGTCGTCAAAGGGTCagccactcttttttgcctcaAATTT TATGATTGTGTTATGATTATgtaatgttttttgaataatagTTTTGAAAT CTTTAAGGTTTAGAATATCCCAATACTTTATGTATTCCCAAGATTGAGCC TACTGTATTTTTAGCTCTTTATGCCGGCTAGTTACTTAACTAGTTTCACT ACCAATTCTTTGGACTTATGAGTGCAACAAATGGAAAGGAAAAGCAATAA AGACCAAAAGGCAATAgatgaaaagtttttcaataaagGAAAACTCTACt atacaaaaatacaaaggtggtttcccttgaaaaatacaaaaaataaaaag tgattttccttgagaaatacaagcaatgaaaaatgatttaGATTGAAAAA ATGTAATAACTGAAAAGagattttccttgagaaatacaagaaatcgaaaa ttttgcCAATAAATGAAAAGTGGTTTTCCTAGAGAAATACAGAAATTTTC AAGTATTTGTGAAATACAAGCAATGAAATGATTTGCCTTGAAAaaatata ctaaatgaaaagggattttccttgagaaatacaaataatgaaaattgatt CTAATTGAGAAATAGGGAGAAAAAAACATAATTCATCCAGAAatacaaaa catgaaaaaaaaaataataaaattatgAATAATGATCGACTTTGTGTATG ATCATAATTTTATAGATTGAAACACCATTAGATGACTTAGAGGGTTGTCG CCAAGTTGTGAAAAAATCGTTAGCCACAATCAGACAGGACCACAAGCGTG CTCTCAACCCGACTCCTTACAAGGTAAGTCTTTTCAGCCTTCTCAAACAT TTCTTCAATCATAATACATGAAAATGACCAGGTAAAGGATCTGCATATTA AAGTAAGCAGCAGTAACATGAAGGTGCATTATCCACTTATGTTGTGCAAG GTTGCATGTttaacccccagccgggtcatccAAAGATTCACAAAATGGTA CTGGATGCCACTCTGCTTGATGTGGGCATCTGAAGAGACATCACTTGTAA GtagagaaatccagggaaaggattGGCAACCTCCCCTATCTTCAGGTAGA CATctagagaaaagggagcctcCGGGTCAACCTCCACTGCGGTCACAAAC TTATTTATAATAGTTAAAGTTTTGGTATAAGGGTATACATGATTTGGTAC TTCTAATACTGTAGACAGACATAATATTTTAATCCCTTAGTTAACGTTGA CCCATCATTAAACCATCATTATTCATCCATCTTCTTACTTATAGGTTTCA GTGACCACAGAGTTATTCCAATTTATGCATAATTTATGGATGGACTGTGC ACCAATCAGCGAATTATCATAgattaaaacctttttttaaaggtgTTGAG TACCAGACCATTTCGAACATAGTTAGTAATGATACTCTTCCTCTTCTTTA CACCTTTATCAGTCATACAAGTATAATTCGAATTCCCCTTTCTTAAGGGA GAAGGGGCATATTATCGAAGAAAGGGGAATTCCGGAATTTTCCTCAAAAG GAATGGGATAGCAAGAAGGGGGTCTACATAATTAgctttcaaatttcttt tatattcaCTGTATTAGTCTAAAAACCATGTTAAAGGTTAAGAACAAAAC TATTAAGGGATTTTAGGGTCCTAGCTAAGATGGGTAAAAAGGGACGTTTT CAAAGCACTTTTCAAGGTTGGGGATACCAAATGGGTCATTCAGAAGGATT GTCAGACCCCTTCCACCCTATTACAAGGATAATGGGTCTGACGGAGAGTC TTCAAAGAGCATTATCCTGAACAAAATACAGAATTATTTTCCCTTCACCT TTATATGCTACTAATTCACAAAGTTCTCCCAACGTTCATATTTCGTTGTA TTGTGTTAGCTGTTTAATAAATACTTCTTATAAAATTACACAAATACCCC CAGTACAATCGATATCTTGGTATATTTTAGATAGATTTATATACACATTA TCTTTTGTTTTTGGAACACAGTTTTAAATGTCTTCgaccaaaatttcgaa aaatgtaaaaaattttatCTACATAGTTAACTCAAATAAGAGTTCAGGCC AGTAATcttaaaataaattataaataaGATTTTAAATCTAGCTTTTTTCC AAATTATCGAAACCAtattgtaaattatttttttaaaggtatttttttta cttttttttctgaTTCGTTCTGTTTTGTAATACTTATTCCCATATAACTT TGAAGAGAGGGAGTCTAGGGCTTATCCCACATTAAAGGTGAACNTGTAAA AATTTTTATCTACATAGTTAACTCAAATAAGAGTTCAGGTCAGTAATctt aaaataaattataaattatttttttataggtatttttttttacttttttt tctgaTTCGTTCTGTTTTGTAATACTTATTCCCATATAACTTTGAAGAGA GGGGAGTCTAGGGCTTATCCCACATTAAAGGTgaacattttgtttttgta tttatatGATACGATTTCTTTTTACAACACTCGATATCAACTTAATTTCT tgtacatttttaattttagttattatatttaattttttgataattatGAT TATTGGTTATCAATGTTaaagatctttttgaaattatctttAGAATTGtt ataaaatatagaaaattttGTCTTTACGGTGTTTCATTTCTTATTTCCAG GGATCTGATTTGTGAA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000005XLOC_000005Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000007-exon-sc0000001-1491911889:135795..136022TCONS_00000007-exon-sc0000001-1491911889:135795..136022Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:135795..136022TCONS_00000007-exon-sc0000001-1510915933:135795..136022Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:136275..136436TCONS_00000007-exon-sc0000001-1491911889:136275..136436Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:136275..136436TCONS_00000007-exon-sc0000001-1510915933:136275..136436Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:136607..136655TCONS_00000007-exon-sc0000001-1491911889:136607..136655Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:136607..136655TCONS_00000007-exon-sc0000001-1510915933:136607..136655Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:136936..137066TCONS_00000007-exon-sc0000001-1491911889:136936..137066Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:136936..137066TCONS_00000007-exon-sc0000001-1510915933:136936..137066Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:138205..138419TCONS_00000007-exon-sc0000001-1491911889:138205..138419Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:138205..138419TCONS_00000007-exon-sc0000001-1510915933:138205..138419Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:138795..138892TCONS_00000007-exon-sc0000001-1491911889:138795..138892Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:138795..138892TCONS_00000007-exon-sc0000001-1510915933:138795..138892Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:139002..139142TCONS_00000007-exon-sc0000001-1491911889:139002..139142Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:139002..139142TCONS_00000007-exon-sc0000001-1510915933:139002..139142Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:140587..140667TCONS_00000007-exon-sc0000001-1491911889:140587..140667Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:140587..140667TCONS_00000007-exon-sc0000001-1510915933:140587..140667Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:141410..141512TCONS_00000007-exon-sc0000001-1491911889:141410..141512Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:141410..141512TCONS_00000007-exon-sc0000001-1510915933:141410..141512Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:141763..141920TCONS_00000007-exon-sc0000001-1491911889:141763..141920Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:141763..141920TCONS_00000007-exon-sc0000001-1510915933:141763..141920Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:142660..142767TCONS_00000007-exon-sc0000001-1491911889:142660..142767Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:142660..142767TCONS_00000007-exon-sc0000001-1510915933:142660..142767Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1491911889:143239..144660TCONS_00000007-exon-sc0000001-1491911889:143239..144660Clytia hemisphaericaexon
TCONS_00000007-exon-sc0000001-1510915933:143239..144660TCONS_00000007-exon-sc0000001-1510915933:143239..144660Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:135795..144660 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0 0 0 0 0.211989 0 0 0.205252 0 0 0.804945 0.156929 0 0 0 0.274799 0 0.218429 0 0 1.5756 0 0 0 0 0 0 0 0
Blast
BLAST of TCONS_00000007 vs. Swiss-Prot (Human)
Match: PNCB (Nicotinate phosphoribosyltransferase OS=Homo sapiens GN=NAPRT PE=1 SV=2)

HSP 1 Score: 326.635 bits (836), Expect = 5.857e-119
Identity = 156/322 (48.45%), Postives = 212/322 (65.84%), Query Frame = 3
Query:   42 QPLLTDFYQISMAYAYWDNKKMNDHAVFDLFFRKNPFKGEFTIFAGLSECINYVKNFKFSEDDIEYLVKVMPESTDPEFFTFLKNLTTNEVTISAIPEGTVVFAKVPLIRVEGPLAVVQLLETTLLNLVNFASLVATNAARFRHASGEDKLLLEFGLRRAQGPDGGLSASKYCYLGGFDGTSDVLAAKKFNIPVKGTHAHAFVSSFHKADDVSQFHKLLNKNSQQNESLLPTVEKKLQEVADIFKISKDQVNQGELMAFTAYASSFPSYFLALIDTYDTLKSGCINFLAVVLALKDFGYQSIGVRIDSGDLAYLSKELRKMF 1007
            +PLLTD YQ +MA  YW   +  D A F+LFFR+ PF G F + AGL +C+ +++ F+  + D+++L  V+P  TDP FF  L+ L  +EVT+ A+PEG++ F  VPL++V GPL VVQLLET LL LV++ASLVATNAAR R  +G +K LLE GLRRAQGPDGGL+AS Y YLGGFD +S+VLA +   +PV GT AH+FV+SF  ++                  L    +  L++V     +   + + GE  AF AYA +FP  F  L+DTY   +SG  NFLAV LAL + GY+++GVR+DSGDL   ++E+RK+F
Sbjct:   14 RPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGLRDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVPLLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGLTASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVF 335          

HSP 2 Score: 121.709 bits (304), Expect = 5.857e-119
Identity = 66/181 (36.46%), Postives = 105/181 (58.01%), Query Frame = 2
Query:  998 ENVHKAFRKGHSINAFGIGTHLVTCQKQPALGCVFKLVELNGDPRMKLSQDIAKVTIPGKKNIYRLYGHDGLALLDLLTKADEKAP--GIEERVLCQHPIQGAKRAYVKPKVIESLLKVYWKNGKIETPLDDLEGCRQVVKKSLATIRQDHKRALNPTPYKVSVTTELFQFMHNLWMDCAP 1534
            E + +  ++G  +N  GIGT +VTC +QP+LG V+KLV + G PRMKL++D  K T+PG K  +RL G DG  L+D+L  A+E  P  G E RV    P    +   V+P  +E LL++  + G++  PL  L   R + + SL+ +  +H+R  +P  Y+V ++  L   +++L    +P
Sbjct:  361 EALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRV---WPPGAQEPCTVRPAQVEPLLRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVVLSERLQALVNSLCAGQSP 538          
The following BLAST results are available for this feature:
BLAST of TCONS_00000007 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
PNCB5.857e-11948.45Nicotinate phosphoribosyltransferase OS=Homo sapie... [more]
back to top