TCONS_00000005 (transcript) - C. hemisphaerica

Overview
NameTCONS_00000005
Unique NameTCONS_00000005
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1534

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000005 ID=TCONS_00000005|Name=TCONS_00000005|organism=Clytia hemisphaerica|type=transcript|length=1534bp
AAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGAC
ACAaaatcataTGGACCACTCAAGgatgaAGACAgaatatttacaaattt
ataTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGAGACT
ggtacaaaacaaaagaaattatagtCAAGGGTCATGATTGGATTCTTGAT
GAAATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCCCTAC
TGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCAAAAT
ATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGATCGT
GAAATTATGAGACATGACCCACACAAATTGGTAGAAGGATGCCTGGTAGC
TGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGTGAAT
TTTATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATACAAA
GCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCGATGT
TTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACTGCAC
TTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCA
TTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGT
TGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGT
TCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAACATC
TCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTATCCC
ATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGATGGG
ACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCACTCATCCCT
ATAGATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGAGC
ACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGAGCG
ACATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGAAAGT
TGTGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACAAAAT
CATGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGATATGT
TATGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCTCGGT
GACGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGACCAGT
ACTGGAAGCCCGTATGAACCAATATCAAGACGATTTCGATACAAAAGTGG
CTGCTGCTGTCTAATACTTTAttattaataaaatattgaatattgatCAA
ATGTATTTTCTATCTATCTATCATCTCTATCTCTCGACTAATTGCGATGG
TTTCAAAACTCGAAGTGTAAATAAGTTActgtattatttttttgtttttg
ctcacgaaaaaatgatttttattttgaatgaagA
Run BLAST on NCBI

transcript from alignment at sc0000001:107381..125749+

Legend: exon
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000005 ID=TCONS_00000005|Name=TCONS_00000005|organism=Clytia hemisphaerica|type=transcript|length=18369bp|location=Sequence derived from alignment at sc0000001:107381..125749+ (Clytia hemisphaerica)
AAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGAC ACAGTAAGATCATTTATAATTTTGAACTCTTCAATTCCATAattaaaaat tcattaaatttgattctCGCGGAAATATTAAAACTAGGAATTTTTCCTAA AACCATAGGTGTTTTGCCACTACCTCtaggaaaataaagaaaaactattA GGGAAAACGAAtccttttcgaaaaaaatcatttccagccaaaaatgccgg aaatatgccggaaaaaacgtttttttggcattttctcgagatttcatcat tagttttttcagattttttgcacaaagatgcgtattagcaatgcccaaaa gatggcagagtccgatttttgagaaaaattattttccggccgaaaatgcc ggaaatatgccggaaatcgccgtttttgcagattttcatcagactttttc cttatatttcgttgttttttcatacaaaaacattatcaatagcaatgtcc acgatcaagcatggttcaattgtcgNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNtttcttgaatttctcgagctgtacttt atatttttttatgaaattttgcacactgatgtaaaatgacaatacctaaa aagtgacggagcccgattttaaaaaaacatttttttctggccgaaaatgc cggaaaaacgccgaaaaaactggttttttagcattttctcgagattttat cattagttttttctgattttttcctcGAAGATGTGTATAAATATTGCCCA AAACATGTCCTActccgaaaatgctggaaatatgccggaaatcgctgttt ttctggattttcattgaatttttcctcataattggttgttttttcattca aaaacattattaattacaatgcccaccatcaagcatgtttcaattttcaa taaaactgatttttgaagccggaactatttaaaaatcaccGGAACAACTT ATTTTCaacggaaagacagtatttcttgaatttctcaagctgtactttat atttttttatgaaattttgcacaccgtaaaaaacgtttttttacattttc tcgaattttcaccttgatttttttctgatttttttgcataaagatgtgta ttcgcaatgctcaaaacatggctgagttcgatttttgagaaatttttttt ttccggttgaaaatgccggaaatcgccgtttttgcagatNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttttgcagattttca ttagattttttccttgtatttctatgtttttcacacaaaaacattattga taacaatgctcaccatcaagcatgattcaattgtcaataaaactgatttt tgcgaccagaactttctatttattttttccctccAACCCttcctctcccc ccatcaacaatcaatgatgaatttattatatatatatataaattttacaa tcAAAATCTATTTCTAGAAAAAAGATTGGACCTAGAACCAAGTTCAGTGA ATTGGTTTTAAGTCGATCTGCCAAGTTTCTTGCCTAGGGAAATATTACAC AATTGGTCAATTGAAACATTTCCATTATCAGTCACCTGATTGAGAAGTGA CTTTGCTGGTCTACCTCTTCTAACATTTTTATCATCGTTAAAAGTTAAAC ACTTAacattgcgttatgcattttcactaaacgctatattttctgactga tttttttctcctcacattgctatctaacttttatcatcaggtaggtccat tcagcatctagcttgttatgTAAAAATTGTTGTTGTCAGCGGCTTCTGCA TGATGGAAATTTATGCATGAAATTCATAAATTATTATGATCATtctataa ttatttttctttttttcagaaatcataTGGACCACTCAAGGTTTGTTGAT AATTATTTtgttaacaatttttttttctaattcttaTGGTATTTCAAATT GAATAATCTCATTTTGTTCTAAACACTTCGTCAATTTTTAACGTTGCTAA AAAAAGATTCTGATCTATTTATTActtatcatttttttttcaggatgaAG ACAgaatatttacaaatttataTGGAAGACATGATTGGAAACTTAAAGGT GCAATGGCAAGGGTAGGTAACTAAATTGGTGTGCAGCATTATGTACCCAA TGTACTTCAGGGAAAATGGTTTCACCTTGATTGACTGATCATTACTTTTT AAagtgaatacaccttttcgaccgtagttgcGCGGTCAGCCGcatgccac ttaattatttaattatccccctaaactcgatccaagacacctttttctat tgtctctaggtgcgaaaaaaggattgggacggttttagtgggataaagta gacaaaaaaatgcctgcgtggcaattggtggctacggtcgaaaaggtgta tacatGTGTTAGACCAAACAACTGGTTATAATTCAGTGCCTATCTTAGCT ATACTTTAGCCCTAATCATTTAACATGTAAGCCCTTTCTCAGCTGTCAAT TATTAATAACTTTATAGGAAGCTTCgagattttctaaatttctgtTTAAT ATatatttggctggaattttatcACTTTTACACCATATAAGTGCTACCAG GGAACCAACAATAATACACATTTCGAGACAATTCTTATCATCAAAGGCTT ACTATAGTGCCAATATAGGAAAAGCACAATGACCTCAAATTTAACCACTT ATTAATGGAGGACTCACTCTTCCATTTTTCAGGGAGACTggtacaaaaca aaagaaattatagtCAAGGGTCATGATTGGATTCTTGATGAAATCAAAAC GTCAGGATTACGTGGACGTGGTGGAGCAGGTATATTGAACTTTTTGATTA TCAAATAATATTAGACATGGGGTTAAATGACAAAGTAGGCTACAACAAAT TTAGAttaacttttcttttctttctggcAAGAGCCAGTAAACCCTATAAA TTTTATAGAGAAAGctaatattcatgatatgcaccactgcaatgacttca cgaacaaattatgcaacttttctgtcgtttttttccacccaatacgtcat tttttctattgttaaaGTGACGTATTAGGTGGGATATTTTAAAAGtcctc agaagactctccagtggtgcatatcatgaattgaacgGCATTAGCGAAAT GCTAtttcaaaatacaatttttccaTCCCACAATTAGAGCGGAATGAAAA TTTCCATGCTATTATTGACTAACCTCAACCTTTAAATGaccaatattatt tttttgaacatttttgcaGTGTGACAaggaaattatttaaaactcATTTC TATGATAAAGTTgtaaatacactcttctcgagatgcataaatttattgtt gtcctcgttttcaaacagatttcgttgtaatgaaattatacatttaaacc aatttaaattcccaaaaggcaaacattaactctaaaacaaaagtacatga aattcaaaatgtctcatgagttgtaaacaacacaattatcattgtgaata tgcaattttatagcaatgaaatctgtttgaaaacgaggacaacaataaat ttatgcatctcgagaagagtgtatttgtatgttttattttttatatcatA GGTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGG TCGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTT GCAAAGATCGTGAAATTATGAGACATGACCCACACAAATTGGTAGAAGGA TGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACAT CCGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTAAGCTCTATAT TGTATACAGTTATATAatccaaaatgttgttttttgttgaaaacctCTAC AGGTCGCCTCTAAcccagtgaaaatttcaagcactcttttgtggcCGTTA TacggccaaaatactcaattttgAATTCAGTTTTAAAACTTTACTATGTG TCAGCAAAGTAGCAAGAATATGTAAGAAGGTGggcaaaatcaaatcaatc cttgaaaataaacttttcatCCAAGAAGTCTTTAGACAAATTTCCGTACT CCCAGattaaaaaaagaatctttGTTAAATCATTATAAGAAGTTTATTTA TTATTCTGAGGATAAGAGGATTATCGCAGTTGACTGACTATCTAATAGTA ATCACACAGTAATTTCATTCTTTGCTTTTACTTCTTAGGTTGCCATCAAC GAAGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATA CGATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCG AAGAAACTGTAAGTACTCTACCATAAGCATAAGATCTCGCCTTTTTGCTG TTTGCAGGTCAACATTTATATATGCTTGAGCTTTTTGGGAGAATATTCAA TAAAGCTGCCTCGTTTATGGAAACAAAGCAACAGACTCAATCATAGAAAG TTATTAATCAAACATATTCAAGTAGGGGAGATGTATTTTGTACCACTGTA TTTTAAACTCCTATCGCTTATGTTATCCTTCACTTTAGGCACTTATTGAA AGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGC TGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAAACTG TCGCCGTCGCTCCCGTAAGTTTACAATAACACACCTTTCAACCCTTGACG CCTAAAAGAGATAAGGCCTAAGATTACTTTGAAGGAATGACGGAGAAAAT CAAGGCAAGACTTCAGACGTCAACCCTACTTGGTAAAGATTAGTGTATAT TGATCAATAAAATTTGTGGAATGATCAATACAATTGAATGATTCTCTCGG ATAATTTTCCGTCACTTAAAAGTTCTAAATCTTGCGGAATTTTCGCATTT AATTTCCCCATTTGGTCAGGGAAACCAAATACTTGTAGTATCGCTTACAA AAGTTTATCTTTTCTCAAGCTTGTATCACATGCGCACAATAAATCATCCA TAACAAGTTTCCCGCAATATAATATGGCTGTGAGCACTGCTCTATAATCC TAAGAACTAAACTTTATGCGCCAACTTTGATTGAAGTTTTATTGAAAGTG GTGCCCGCAAACCctgggtatataaaggtcagtcgGAAATATCGCTCTCG GTACATTTTCACCGgtattgagtagtgctaccattatgGCCAGGGCTTAT AAAATGTCAGTTGCTGGGAGTTGAATAAAACTAATATTAAATAAGGACAA TTATTACTGCAAAATGCAACCGGTGCACTTATTATGACGTTATTTCTATA CGAATTATTATTCTTATACCATAGGAAATTTGCCGTCGTGGAGGAAGTTG GTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGGTAATCTCAG CCAGGGataaatattaaatgagcttttgaccGCGGCGATTGGCAATCGGT GAAAGCAATCGCCAAAATCAAACGTCAATCGTATACATAAACAATGTATA GACATTAGAACCGACTTGGTTTCTTTTGAAGTAAAAAACAACGCAGTTTT GATTGAtttggctgaacaaccaggtcagatctTCACATTCGCCATATCCC TTTAGACCAGAGTGTGGTATGCGCAGAATgaatgatctgttatgagataa gacaaaaggttgaaattgactaattaatttttgggaacaAAGTGTTTGTT ATGAAGTTGTTCCATCCTGTATCTTCTTATCTTGATAATCGActattcct tgggtgaataccggggggcgttttttttattttttgaaaattttcaattt taagggcttggtcacgagtttttgccaaaacgaggctaaaactttggggc aggctggagacttcaaaaatgatcagatttggccgaaattttgcacactt gatacTTGGGCGAATCCCTGGTGgcggttttttcattttttcaaaatttc cattttcaagggcgtggtcacgagtttttagttgaaattggttacaattt tacaattgggcctacgaatgatttaaaaacactgaagttgagcccagtgc ggttagcacgttcgacagtctTGATAATCGACtattagaccatgttcaca cgctACATATCCGTTTCGCTCTGAAACGAAATGAATCCACTCTATTGGCT AAATTCAAGTTTTAAATCACTTCTGACCaatttaaaatacattcattttG TTTTGGAGACGTAGCGTGTGATTCAGTTCagtttcatttcaaaacattcg aaatccCGCTGGTTGGCAACCAGAAAAGGAAACAACATGGTGTAGTCAGC TCTAAAACTGGACAAACTTCCTATCATAGAGGaagcccgatccagtcaag CGGTTAGGAATCAGTGATTTAAACcacataaattatttttctcttcttta gCTTTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAG AAATGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTC ACCGGTAAGAATCTTCTACAGTGATAAAAGTTCTTCTATCTCAGATGGAT TTCTAGCGAGCACCTCATTAataaccgggatttttcatctcgtttcttag tgagttccactttgacgatctTCGAAAAAtaaagcctttcaagtgttttg acgcaaattccatttttccctactgcaagggctttaaaatgacgtcaaaa aatcgaatgtttggagtccgaaaacctgggctcaaaacattcgaaaaagt tgcaaagtggaatagacgttaattgcgtagaaaaaacgcgggtgacatCT AGTATAGGCTAATGGATTATCGTCTCAGTGAAGTATATAAAGCTTTTTGC GTCTCAAGCttctgcataattcaccaaaacttcaagaatatgtgcttatt tgctgtgtaaaatccattttacGTCTCAGATGTGCaaaaaactttggttt aacCACGCCACGTCTTATTTTTCTGCAGCATTATAGCCTGTACCCGCGTA TAGTGCAGAGGGGTTCAAGGTCCGTTCCTAAAATTTTAGGGTCCACCACT TGAGTACTCCCACTTGATAGTTGATTTGCCAATCCTCGTAACAAGGGATT GAAATTTgacataaaattttgatttaaaaaaagctcTGTTCGtagacttt tttttctttcctccaTTTCAACTTGTGCTCAGGTAGGTAACTCTCAATAT AGAATTAGAGATTTTTCAGAGACTTTAAATTACATAGTTCGGAGAAAGTT CCTGctttaagaaatttttagaagCCACTTTTTTAGTCCCAACTAAGCCT ACCCCCTCCTCTCAAAGTTCTGAATTTCAAGGTCCCTGGTCAATTTAGgc ctaaaaaacaaaaaattacatttaaattcaaaattgaaaaacttgacTGA CTTGACACAAGTTCGATTAGCTACTACTGTAGAAGCTTAGAAAATCAAGA GTGACGTCAATAACGTGAATGTTTCGAGCCAAAGAACCTTGACTCTTGGA TAATACGCTACGGCATATGTAGAAAAAACCGAGACGTCTCGAAGAGGCTA TATTGTTTGTCACCAATAAGTCCTAATCTACCGCACACGAATTTACAAAC GTGTAACAAACACAACTGGGTTGTGACGTAATCAACATGGTCGTCGATTT CGGGTGGTCTCTTCTAGTACATTATCTAGCTTTAGCTTAAGGTTTAGTGA AAATGTGACCTCTGTAGTTTGTTTGTCGGTTTGTGTTTTATTTCAAGAAT ATATTTATAATCAGTTCCGAATATCGTGTTTCAATTTTATAGCTCTAAGG TTTATTTGATCTGAATTATTGTATAGTCTTATATAAAGATGATACGCAGG CAAATTTCCAgcgtttttatttcaaagattgaGTTTGAATTCAGTTCGAA GAACAAAATAATCAACCCAGGCTCTGTTTAATTAGTTGGGTActattaaa acacaaagaattaaccTTAGAATGGCCTTTTCTGTTAATTAGGGTCTAgg acatcaaatttttgtcaCGATTCTCATGGCTCAGGAAAGGCCTGTGAATT TGCCTGACACGTAATCTACAGTCGATTGCCAATTGGTGAATTCTGAAATT TCTTTTGCAGACTTTCTGTAGAAAGTTAGCGTTTTGTTCCTATGATATAC GTCGGAAATTAAGCAACGAGTTTCTAGTGCTTCCCGCGTTAGAATTATTT GCAAGACATTCTcagatttttttcttaaatcttTCTGTTGCATAACTTTC GCGTGTAATCTTTTACATCCAGAAACCTCCCGGTGTTGCTGTCAGCAGAA AGGTCAGACATAATAAAACTTCAAAGACACACAGACAGCTTTTGTTATTG CTCACTGCATGTCATCTTAGAACCTTCGTTTTAATCTGAGCTTTTAAACC TAGTGATTAAAATTGTTTCCTTAtttttctgtgagattgcataACTAGAC CCAAGAAGCATAGAAGTTATTACAGAACGCAAAATTGTTCGAGCTCAGAA AATTTCGAGTTTTGGTGCAATaataaggtattgttaactgaaaatCACGT AAAGCTTCTTCGAGTTAGGGAAACATTACAGTTAAAGAGGTAGATTACtg taatttctttaaaaatctaaagaatcctaTTGTTACAAATCTTCTTGATC AGAGTTACATAAGACAAGTGTTAGTCAGCAAGAACATGTGACAATCACTG CTAAGCTCTATGCCAAGCTCCTCCTCCACTATTTTCATTTAAGAAGTGCT TTCCATCTTTCCTTTGGCAACATATGAGATCCGCTACATCAGCAGTTTGT AAACTGACTAATCCGGATGTATTTTTTCGTACATCATTTCTGCTGATTCT GCAATTTAAAgttgattttacattttctttttttgccatgTTTTACCATC CTTGACATCCTACTGTTTTATGAATATGGCGCCAGAAATACTTTAACTCT GGCCTCCTTGAAATCAGAGCAATACGTTGACACCTTCCCGAAATGTCGCA ATGTTCATGACGTATTTTTAGTAACGAAGACAACCGGAATTTCCAGTTAT CTAGAAATTCCACTGCTTTATCATTCAATNATTTTAGTAACGAAGATAAC CGGAATTTCCAGTTTGCTATAAATTCCTCTGCTTTATCATTCAAACTTCA CGAGAAACGCTCAGTTTTTCGGTATCCCTCTACATAAAAGAATTGTGATT GACCCTTTAAACGATCATTGTAATGACTAGTCTCTTAAGTGTTGTTATTT TTGGAAACAAGGGGAATCTATACACCCTATAAACACCCCCTTACTTCGTT atatattgtatattttttgtttaagaaTATGGAGCCGTTTTCTAGTTGAA CGACGCAAGTGATCTAAAGATCAAGTAGCTAATAATTGAAAAATAGGTTC TACAATTGCTTCAATAAAACTGTTCATATTAAGATTAGAGCATTAGCCAG CCTTAAAACTCTTACCATTGGGACTGTGTGAAAgccatttttatgttttt tgtgtTTGTTGGAAATCTCGAAACGAGGTAGCAAGAAATTCGGATACAAA TGACAGTCGACTTATGACAATATGTcctaaatgaacaaaaaatgcCTTAA GTACAGTAGAAACTACTATGTAACCCTTAATCATGTTAACTATACCGATC TGGTCAAAGGGATTCGAACAGTTTTTCTCGTCAGCTTTTTCTCAGGCATT TCTCGAACAATGTGATAGGTCTGTTGCTGAAGACATTCTTCTCACTGATC GTCTATATTTAGTTTTAATCTAGGCTAGACTGTTACTAGTCTAGTAAACC CTCCTTCTACAAGACATGCTATTGTCCAGAGTAAAATTGTGAGCAAGTAA TTACTACACTCACAAGAACAGAAGACGGCGGTTGATAcaatttcttacaa aaaaatgttCATGTACAAAATCAAATCTTTTGTTATTTGTTCAAACAACA AGAAAGATGAGAAAATattccataaaaaaattatcgagTGTGACACAAGA AAgtcattttttatgagaaaaacatttttagtcaaGTGTTGACATAAAGA TTAATGACAGAATGGAGAGAGAGAAAACACCGGTCAGCTAACGTACAGCC ACTAAGTGATTCTTAGGTTACAACAAGAGACAGTATATAAAGAGGTGGCT GAGTGTTGGTTCGAGTTTCAAAACCATACCAATTGAACTGCGAGACGGTC AGTCTTTTTTACTGCAGAGAACGAGGACTGTTCTGACcagaaaacaaaaa catgcaTTGGTTAGCCTGTGTTGTTTTAACCATTTTGGTTATCGACCGAA TCCAGGCTACTGAATTACCTGAAGAAAACCTATTGGTTCCGGACTTGATT GAATATTGGGGATATCCTGCCGAATCGCATGAAGTCCAAACCAAAGATGG CTACCTGTTGACTTTACACCGTATTCCGTATGGTAAAGGACATACGGACA CAACCCGGAAACGACCGGTATTCTTTTTACAACACGGACTCCTTTGTAGT AGCTCGAATTGGGTTACCAACCAACCACACTTGTCTCTTGGATTCATGCT CGCTGACTCTGGTTATGACGTATGGATGGGTAATAATCGAGGCAATACTT ACTCCAAGAAACACGTGACTTTACCGGTTGACAGCAAGGCATTCTGGGAT TTCTCGTTCCAGGAATTCGCAAAATATGACATGCCCGCCATGTTGGGGTA CGCCTTAAATGTGACCGGAAATAAACAATTGTACTACGTCGGACACTCTG AAGGCACCATGATGATTTTCGCCGGTTTGAGTGAAAGTGAGGAGCTACAG AAAATGATTAAGACAGCCTTTGCACTAGCCCCTGTCGCGCATCTGGATAA AGCCTCATCGCCTATTACTTATCTATCATCTTTCGAAACTGAAATTGGAG GATTTTTCGGTTTTCTCGGCGTCCGTGAGTTTATGGCTTCTAGCTACTGG ATACGTAAACTAGCTGACTTGACTTGCTCTTTCGATGAGGGCGCCCTTTG TGGAAACTTCCTTTTCTTGATTGCCGGTTCAGACAGTCGAAACATGAACG CCACTCGCACGCCCATCTNTTCTTGATTGCCGGTTCAGACAGTCGAAACA TGAACGCCACTCGTACGCCCATCTATTTCACACACACGCCCGCTGGAACA TCAGTTAAAAATATGCTTCATTTCTGCCAGCTCATCGAAGCAGGGCGTTT CCAAAAGTACGACTATGGGTGGGCGAAGAATCTTTACCACTACCACTCAT TGAAGCCTCCTCAATACCcaatcaaaaacatcaaaacggAAATCGAATTT TTCTCTGGGGGACGAGATACCCTCGCTGACCCTCAAGACGTTTCATGGTT GACTACGCAAGTTAAAAGTCTCACCAAACATCACGTTATCCCGGAATACA ATCATTTAGATTTCATTTGGGGCGAATCAGCACGCCGTAAGGTCtataag aaaatcattaaatctGCTTATCGTAAAGATGGCATTTTACGACGATAAAT CATTTCTTTTTGTGACTGGCAGAAAACTGTTTTTGATTGGATGAAACTTG TTGAAAAAGTAGATATAATCAACGGACAAGACTTTGATATCATGTTGCGG ACAATATTTAAATGGTACAAAAAAAACGAATTGCAAAACTCTACGATCTC ctacaaatatttttgtttctgtgGTAGTTGGTTCCCTGTAATATGTTTTT GCACCAACATTAGATGTATAATGTATGTTAAAAAAGTATTATAAAAGTAT ATTgaataaaaggaaaattaagGAGGAAAGCTTCGccacttttataaaaa tctttaTCGCAACTCCCTTGAAGTAGACCTGAAAATATTGTCACTTTCCC CCCGACAAATCTTTCCCCTTTAAGGTACAGTACTTTTAAACATACGTTGT GATCCcttattttcaagtttttttcacACTGATTTCACATACAAGTTCCG ctcttcaaaaataaattacagTGCATAACTCGAACAACATCACGAGGAGC GCAAATTTGTTCGgtttatggaaatttcgagttagaAGATGAGATtggtt tataaggtattgttaactaaagagaccagaaaacttgttcgagttaagga gatattcgagttatagaaattcgagttatggagctGCCACTCTATGATAC GATGATGCGAGATTTGTAAGCCCTTTTCTAATGTCATGATAGATCTCATC TTTCGGGTGTCTCCTTTCTTTACTTTTGgattgattttcgaaaaaatttc gtaATCCTAGAAATGGGTAACGAACGTGTCTGTCAGTGCCCTtgtaaaat tatatattttgaaaaataattttcttacatCAAGAGTCTATTTCGAGAGT CTTTTTACTCCTTTTTTTTGTTAGAACAATTAGGCTCAAAACGAATTCag cataagaaaaaatttgtctcaaagtatcaaataaaacaaaaacagccAAG CCTTAACAAAAATGTGTAGTTTGggtcttccagaaaaaattggaATATGG AGCGTGGAGGatataacttttttttcgaaatttaaccaacgaacattgtg acttttgactcGCCGGACAACAGGTCTAACTTCCCGAACACCACCATCAG TTGATCCCGGACAttcaaattacccccaaacagagcaagtttcccccccc ccccggacaaggcacattttgtagatttttcaccaCCCCCCTTGGACAAT TATATCCTCTACTCAACATGTACAAACTGGAATGACCCGTTCTTATAGTA TTGTAATGTACAGGCTTGCAATAGACATCACTTACCCCTTTACACTCCTT CGTCATTTAGTTGTCACTTGTCAACTCTTGTTTGAGTTTAGACAGCAAAC AATATCAATTATTTACATTTATCACATATTTGCGAAGGGGCTTTCGAGCA CCAAGGAAGCTAAAGATCTAAATCCTGTCTTAAGTGATTTTTCATCTCTT TGATTTGATcaaattttccccttttttgtTTACCCTGGAATAAGGCTGTT GTGcatgttttgttttaaaaaccaGGCtagtttgagggtaattttgaacg TCCAGGGTCAACTGTTGCTTGTTCGGGgagttagacctgctgtccggcga gtcaaaagtcaaaattgTCTTTTCTTAAGATATTGTTTTTTGATTCGTAG GTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCA CTCATCCCTATAGAGTAAGTAGTGTTCACACACGTGCATTATTTTATTTC AACTCCTATTTTTGGTTTACGACAAAAGGTCTGTTTTTTGTCGTGGatca aattttacattttaatgtcAATATTGCTTGTACTTCTCTATCTCTGTAAA CTTTTAACCTGGGAGAGGTGGGGGCACTGAACTTGACAGCCGACGGGGAC CTGCTGTATGAGtctgaaaagtggaccctgtcggATATGAATATAGGATA TATCGActttttcaccctgaaaagtggtgaaaatgactaaaattagACGA CTAATTTTGACCCTGAAAAATAACCAAAGTCGACTGAACACGCTCAATTA AAATAGTTAGAGATCAGCGAATTAAACATTAAAATTATGTTCTCTTTCTG TGTACAGTGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGA GCACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGGT ATAAAGCTATTTGATATTTGCAGTGCTTTATGGGTAACTTTGACTCGGCG CAAATCATGAGGGCTTGTACTGTTTTAAAATACTTATGCAATCTCGTTTT AAAATCACTCAGGAAAATCGGGTCGAGGCTCAATATGCTTAGACttcgat ttgttgattttctttgggttcatgaaagtcggaaaattgattcgATTCAA GGaatgaaagttttgaaaaagtaaccCTTAGAAAGGTCAGCGTTTCAGTA AAGCTACACGAATTTTTTCGTATTTCAGCTTAGCtcattatgcttatttt ttaccgaCTTTGCGCCTAAGTATGCTtaaaacgttatgcttataaaaaaa gtgtatattcATAAGACAAGAAATATAGAAGCAAGATTCTATTCTCTGCA TTCACAAAGCCATTGTCCCCATTTCCTTAATGACACTGTGGATTAGTCTT ACTGGTGATGTATTGATAGAGCTCAAacgttaatttttgaaaaataactt ctTTTTTTCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTTT TACAAACACGAAAGTTGTGGACAGGTAAGATTGAAGCTTTGAAATGAATA CttgggggtactaggtttgcgagatgacgcGAATGTCCGGACCAAAGATc taaaatcgacccttagagagactgaatttcggaaatttcgtccatttttt aacgtttttgccaccttagagagactttctcccaaaatttcagccaaaaa tttCTAATATCCCTTTCAGGgagtcgattttttattttcgccaacATACG AAAGGCTCGCACATATCCATTTTACCTAAGTACCTGGATGAATACTGACC TCCCTTACTGTCAAGTCGTGCATTTTGATTATTGAAGTACACATTAgcag cgcttctttgatgccagtaaacattcaaaaagatttttgttttaaaaata ctCCGCGGATAAAGCCTTTCCGAATTCTCATTGGGGATCAATCTTGCGGA TGACAACCAAACCCTCAAAATTTTATCCGATTGAAGTAAATCGACTTCTA TCTTTCGAACAATTTGTCTGACCCCTTTATCAGTAACCAAACCAATGTAA ACCAATTGTAAACCAATCATGGTAACtcaaaacaaatttattgagttcCC CGTCCTTGTTCGAGTTAAGTATAGAGGCTAGATGTTcttatttctctttt tattcattcaaaaaaattagtgTACACCATGTCGCGAGGGAGTTGGATGG ATGAACAAAATCATGGCTCGATTCGGTAAGCATCTTCATACATTTGTATA CCTGCAGCTAGAGTTTTTGTGAACTTCTAACGTGAGCTTGTCTGTCAAGC AATCAAACCTTCACCCCCTATTATCCAGTTTTAGGGCCAAAAGCCTCCCC GATTCCAAATTGATGCGCGTTTTAAAACAACCACACCATGGAACTTCACT CATTTTTTATATGGAGTTGGGTGAGCCTTTAAGTTTTTGGAATCCTGCAG CATTTTAAGTATTGATTTCCTAGGAATGGAAATGGAGTTCCAACAAGGGG TATATAGTTTATTTCTGGAATgtggaaaagcccaattcacTCTCAAATAC TGAtagtcaaaacatttttttagtattttaaatTTGACGGTATTTTGCAA AGAATGGTAGGCTTTTTCTTGACGaatgttatatttttattttcagtcgA AGGAAAAGCTAAACAGGGAGAAATTGATATGTTATGGGTAAGTCATCAAA TGTTTCATTGTTTTATAACTTATCGCCGCGAGTATAGCACTTTCAACCAT ATATTAACCTCGAGAATTATTATAATCGATCAGTGGATTTCTATTTATAG GGAACTTAATCGCTTGAGCCACTTGTGAAAGAAAATACCGAACAGTTGAG CTCTTCATCTTTTCACCGAGAATTATTGAAACATGATAATGGTTCCACGG TTGACTATTTTTTCGATTTATTCCTATTTCGATATTATCATATAATGTGG AATTTATTTTTGCGTTTTGCAGGAAGTGAGCAAACAGATCGAAGGACATA CAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGTAAGTTCT CATTGATGATGTTTCAACTTGTTTTTacacattttataagaacaatttta taagaatgaggCTCAAGatcgccaaaaaaataagaacactttaagaacaa tgctgaggctgaaattactcaatttcaatcaattttggGGTCGCAGTaGT ATAAagtataacgcctaaaatacctcacttGCATCAAGAACAGCCGAAcc gcagcaaaattttactggttcttataaaaaaattgtaatgtGATTATATA AATCTATTAAGATTGGAATTgcacaaagaaaaaatgttaTACGTTCATAT GCTTTTTTATGTTATGAGCTTAATCTTTGTTTTTACGGGGTAAAAATCTA TATTTCCAAGTTGGTTGGTCGGAATTTAGCCCCGTGTACTTCTAAAATTG TTCCTGTAGAAATAAGTATTTGGAGCGAGAAAATTATGCAATAAAAATTC TCTGTTGATTTAAAACTAGACTAgcgtctacttctgactgaactttgctt tttgatgattttgatggcgctTAGTCCAGTGAAATAGACTAGGGGATTTc gccatttttaaaatttttcacttttttttcaaaattagaagaaaacGATA TATTCAAAAACCCcatcaaagtttatgaaactataataaaaaaattagaa atacatcaaaaatttgaagaaaaacaattgGTCTATTGGTCATTGTTTTc tgttggtttttttttttttggttttttgaaagtcgtcgttctttttgtct atttttaataAACGTAGGGTTCTTTAGATTAAACCCCCTCCTTTCTTTTA TTTACAGGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGA ACCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAATAC TTTAttattaataaaatattgaatattgatCAAATGTATTTTCTATCTAT CTATCATCTCTATCTCTCGACTAATTGCGATGGTTTCAAAACTCGAAGTG TAAATAAGTTActgtattatttttttgtttttgctcacgaaaaaatgatt tttattttgaatgaagATTTTCTTTGTCTCTCTTTTTTCCACCTATCCAA TCTATAGTTAGCTGGTCTGTCCGAGAAGGATTTTTTGAATAAANNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCTGCG CAGTAgtaaaattgggtataacgcctaaaatacctcacttGCATCAAGAA CAGCCGAacctcagcaaaattttactggttcttataaaaaaaattgtaat gtGATTATATAAATCTATTAAGATTGGAATTgcacaaagaaaaaatgtta TACGTTCATATGCTTTTTTATGTTATGAGCTTAATCTTTGTTTTTACGGG GTAAAAATCTATATTTCCAAGTTGGTTGGTCGGAATTTATCCCCGTGTAC TTCTAAAATTGTTCCTGTAGAAATAAGTATTTGGGCCGAGAATATTATGc aataaaaattctctttagactagagtctacttcatgctgaactttgcttt ttgatgattttgatggcgctTAGTCCAGTGAAATAGACTAGGGGATTTCg ccatttttaaaatgtttcacttttttcaaaattagaagaaaacAATAAGA TATATTCAAAAACCCcatcaaagtttatgaaactataataaaaaaattag aaatacatcaaaaatttgaagaaaaacaattgGTCTATTGGTCATTGTTT Tctgttggtttttttttttttggttttttgaaagtcgtcgttctttttgt ctatttttaataAACGTAGGGTTCCTTAGATTAAACCCCCTCCTTTCTTT TATTTACAGGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTAT GAACCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAAT ACTTTAttattaataaaatattgaatattgatCAAATGTATTTTCTATCT ATCTATCATCTCTATCTCTCGACTAATTGCGATGGTTTCAAAACTCGAAG TGTAAATAAGTTActgtattatttttttgtttttgctcacgaaaaaatga tttttattttgaatgaagA
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000003XLOC_000003Clytia hemisphaericagene
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00000005-exon-sc0000001-1491911889:107381..107433TCONS_00000005-exon-sc0000001-1491911889:107381..107433Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:107381..107433TCONS_00000005-exon-sc0000001-1510915933:107381..107433Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:109500..109520TCONS_00000005-exon-sc0000001-1491911889:109500..109520Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:109500..109520TCONS_00000005-exon-sc0000001-1510915933:109500..109520Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:109674..109742TCONS_00000005-exon-sc0000001-1491911889:109674..109742Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:109674..109742TCONS_00000005-exon-sc0000001-1510915933:109674..109742Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:110363..110459TCONS_00000005-exon-sc0000001-1491911889:110363..110459Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:110363..110459TCONS_00000005-exon-sc0000001-1510915933:110363..110459Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:111232..111467TCONS_00000005-exon-sc0000001-1491911889:111232..111467Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:111232..111467TCONS_00000005-exon-sc0000001-1510915933:111232..111467Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:111869..111988TCONS_00000005-exon-sc0000001-1491911889:111869..111988Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:111869..111988TCONS_00000005-exon-sc0000001-1510915933:111869..111988Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:112219..112344TCONS_00000005-exon-sc0000001-1491911889:112219..112344Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:112219..112344TCONS_00000005-exon-sc0000001-1510915933:112219..112344Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:113005..113070TCONS_00000005-exon-sc0000001-1491911889:113005..113070Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:113005..113070TCONS_00000005-exon-sc0000001-1510915933:113005..113070Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:114082..114184TCONS_00000005-exon-sc0000001-1491911889:114082..114184Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:114082..114184TCONS_00000005-exon-sc0000001-1510915933:114082..114184Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:120831..120894TCONS_00000005-exon-sc0000001-1491911889:120831..120894Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:120831..120894TCONS_00000005-exon-sc0000001-1510915933:120831..120894Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:121288..121378TCONS_00000005-exon-sc0000001-1491911889:121288..121378Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:121288..121378TCONS_00000005-exon-sc0000001-1510915933:121288..121378Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:121892..121954TCONS_00000005-exon-sc0000001-1491911889:121892..121954Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:121892..121954TCONS_00000005-exon-sc0000001-1510915933:121892..121954Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:122601..122655TCONS_00000005-exon-sc0000001-1491911889:122601..122655Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:122601..122655TCONS_00000005-exon-sc0000001-1510915933:122601..122655Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:123077..123117TCONS_00000005-exon-sc0000001-1491911889:123077..123117Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:123077..123117TCONS_00000005-exon-sc0000001-1510915933:123077..123117Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:123403..123471TCONS_00000005-exon-sc0000001-1491911889:123403..123471Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:123403..123471TCONS_00000005-exon-sc0000001-1510915933:123403..123471Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1491911889:125490..125749TCONS_00000005-exon-sc0000001-1491911889:125490..125749Clytia hemisphaericaexon
TCONS_00000005-exon-sc0000001-1510915933:125490..125749TCONS_00000005-exon-sc0000001-1510915933:125490..125749Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000001supercontigsc0000001:107381..125749 +
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
165.578 140.695 148.628 248.095 22.3271 10.0818 19.7653 18.504 44.8446 45.6722 40.7362 40.9552 30.6737 40.0228 34.9188 28.1049 57.7048 70.9747 18.8568 19.7323 134.921 133.85 78.6444 56.7062 19.0454 20.3971 68.1059 55.3786 59.0663 61.5175
Blast
BLAST of TCONS_00000005 vs. Swiss-Prot (Human)
Match: NDUV1 (NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens GN=NDUFV1 PE=1 SV=4)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 363/439 (82.69%), Postives = 400/439 (91.12%), Query Frame = 3
Query:    9 RLSLAISKCLQSTDTKSYGPLKDEDRIFTNLYGRHDWKLKGAMARGDWYKTKEIIVKGHDWILDEIKTSGLRGRGGAGFPTGLKWSFMNKPDDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGRAMGARAAYIYIRGEFYNEASNMQVAINEAYKAGFLGKDACGSGYDFDVYMHRGAGAYICGEETALIESLEGKQGKPRLKPPFPADVGVFGCPXXXXXXXXXXXXPEICRRGGSWFVGMGRSRNSGQKLFNISGHVNNPCTVEEEMSIPLKELIERHAGGVTGGWDNLLAIIPGGSSTPLIPIDVCSDVMMDFDDLVRAQTGLGTAAIIVMNKQSDIVRCIARLIEFYKHESCGQCTPCREGVGWMNKIMARFVEGKAKQGEIDMLWEVSKQIEGHTICALGDGAAWPVQGLIRHFRPVLEARMNQY 1325
            R+S+  S    +    S+G LKDEDRIFTNLYGRHDW+LKG+++RGDWYKTKEI++KG DWIL EIKTSGLRGRGGAGFPTGLKWSFMNKP DGRPKYLVVNADEGEPGTCKDREI+RHDPHKL+EGCLV GRAMGARAAYIYIRGEFYNEASN+QVAI EAY+AG +GK+ACGSGYDFDV++ RGAGAYICGEETALIES+EGKQGKPRLKPPFPADVGVFGCPTTVANVETVAV+P ICRRGG+WF G GR RNSG KLFNISGHVN+PCTVEEEMS+PLKELIE+HAGGVTGGWDNLLA+IPGGSSTPLIP  VC  V+MDFD LV+AQTGLGTAA+IVM++ +DIV+ IARLIEFYKHESCGQCTPCREGV WMNK+MARFV G A+  EID LWE+SKQIEGHTICALGDGAAWPVQGLIRHFRP LE RM ++
Sbjct:   15 RVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRF 453          
The following BLAST results are available for this feature:
BLAST of TCONS_00000005 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
NDUV10.000e+082.69NADH dehydrogenase [ubiquinone] flavoprotein 1, mi... [more]
back to top
Spatial Expression
in the tripal_feature_cv_term.tpl.php