TCONS_00000004 (transcript) - C. hemisphaerica

Overview
Name
Unique NameTCONS_00000004
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length1504

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00000004 ID=TCONS_00000004|Name=|organism=Clytia hemisphaerica|type=transcript|length=1504bp
AAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGAC
ACAaaatcataTGGACCACTCAAGgatgaAGACAgaatatttacaaattt
ataTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGAGACT
ggtacaaaacaaaagaaattatagtCAAGGGTCATGATTGGATTCTTGAT
GAAATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCCCTAC
TGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCAAAAT
ATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGATCGT
GAAATTATGAGACATGACCCACACAAATTGGTAGAAGGATGCCTGGTAGC
TGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGTGAAT
TTTATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATACAAA
GCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCGATGT
TTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACTGCAC
TTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCA
TTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGT
TGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGT
TCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAACATC
TCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTATCCC
ATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGATGGG
ACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCACTCATCCCT
ATAGATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGAGC
ACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGAGCG
ACATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGAAAGT
TGTGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACAAAAT
CATGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGATATGT
TATGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCTCGGT
GACGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGACCAGT
ACTGGAAGCCCGTATGAACCAATATCAAGACGATTTCGATACAAAAGTGG
CTGCTGCTGTCTAATACTTTAttattaataaaatattgaatattgatCAA
ATGTATTTTCTATCTATCTATCATCTCTATCTCTCGACTAATTGCGATGG
TTTCAAAACTCGAAGTGTAAATAAGTTActgtattatttttttgtttttg
ctca
Run BLAST on NCBI

protein sequence of TCONS_00000004-protein

>TCONS_00000004-protein ID=TCONS_00000004-protein|Name=TCONS_00000004-protein|organism=Clytia hemisphaerica|type=polypeptide|length=453bp
SGRLSLAISKCLQSTDTKSYGPLKDEDRIFTNLYGRHDWKLKGAMARGDW
YKTKEIIVKGHDWILDEIKTSGLRGRGGAGFPTGLKWSFMNKPDDGRPKY
LVVNADEGEPGTCKDREIMRHDPHKLVEGCLVAGRAMGARAAYIYIRGEF
YNEASNMQVAINEAYKAGFLGKDACGSGYDFDVYMHRGAGAYICGEETAL
IESLEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVAPEICRRGGSWF
VGMGRSRNSGQKLFNISGHVNNPCTVEEEMSIPLKELIERHAGGVTGGWD
NLLAIIPGGSSTPLIPIDVCSDVMMDFDDLVRAQTGLGTAAIIVMNKQSD
IVRCIARLIEFYKHESCGQCTPCREGVGWMNKIMARFVEGKAKQGEIDML
WEVSKQIEGHTICALGDGAAWPVQGLIRHFRPVLEARMNQYQDDFDTKVA
AAV
Run BLAST on NCBI

transcript from alignment at sc0000001:107381..124517+

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00000004 ID=TCONS_00000004|Name=TCONS_00000004|organism=Clytia hemisphaerica|type=transcript|length=17137bp|location=Sequence derived from alignment at sc0000001:107381..124517+ (Clytia hemisphaerica)
AAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGAC ACAGTAAGATCATTTATAATTTTGAACTCTTCAATTCCATAattaaaaat tcattaaatttgattctCGCGGAAATATTAAAACTAGGAATTTTTCCTAA AACCATAGGTGTTTTGCCACTACCTCtaggaaaataaagaaaaactattA GGGAAAACGAAtccttttcgaaaaaaatcatttccagccaaaaatgccgg aaatatgccggaaaaaacgtttttttggcattttctcgagatttcatcat tagttttttcagattttttgcacaaagatgcgtattagcaatgcccaaaa gatggcagagtccgatttttgagaaaaattattttccggccgaaaatgcc ggaaatatgccggaaatcgccgtttttgcagattttcatcagactttttc cttatatttcgttgttttttcatacaaaaacattatcaatagcaatgtcc acgatcaagcatggttcaattgtcgNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNtttcttgaatttctcgagctgtacttt atatttttttatgaaattttgcacactgatgtaaaatgacaatacctaaa aagtgacggagcccgattttaaaaaaacatttttttctggccgaaaatgc cggaaaaacgccgaaaaaactggttttttagcattttctcgagattttat cattagttttttctgattttttcctcGAAGATGTGTATAAATATTGCCCA AAACATGTCCTActccgaaaatgctggaaatatgccggaaatcgctgttt ttctggattttcattgaatttttcctcataattggttgttttttcattca aaaacattattaattacaatgcccaccatcaagcatgtttcaattttcaa taaaactgatttttgaagccggaactatttaaaaatcaccGGAACAACTT ATTTTCaacggaaagacagtatttcttgaatttctcaagctgtactttat atttttttatgaaattttgcacaccgtaaaaaacgtttttttacattttc tcgaattttcaccttgatttttttctgatttttttgcataaagatgtgta ttcgcaatgctcaaaacatggctgagttcgatttttgagaaatttttttt ttccggttgaaaatgccggaaatcgccgtttttgcagatNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNtttttgcagattttca ttagattttttccttgtatttctatgtttttcacacaaaaacattattga taacaatgctcaccatcaagcatgattcaattgtcaataaaactgatttt tgcgaccagaactttctatttattttttccctccAACCCttcctctcccc ccatcaacaatcaatgatgaatttattatatatatatataaattttacaa tcAAAATCTATTTCTAGAAAAAAGATTGGACCTAGAACCAAGTTCAGTGA ATTGGTTTTAAGTCGATCTGCCAAGTTTCTTGCCTAGGGAAATATTACAC AATTGGTCAATTGAAACATTTCCATTATCAGTCACCTGATTGAGAAGTGA CTTTGCTGGTCTACCTCTTCTAACATTTTTATCATCGTTAAAAGTTAAAC ACTTAacattgcgttatgcattttcactaaacgctatattttctgactga tttttttctcctcacattgctatctaacttttatcatcaggtaggtccat tcagcatctagcttgttatgTAAAAATTGTTGTTGTCAGCGGCTTCTGCA TGATGGAAATTTATGCATGAAATTCATAAATTATTATGATCATtctataa ttatttttctttttttcagaaatcataTGGACCACTCAAGGTTTGTTGAT AATTATTTtgttaacaatttttttttctaattcttaTGGTATTTCAAATT GAATAATCTCATTTTGTTCTAAACACTTCGTCAATTTTTAACGTTGCTAA AAAAAGATTCTGATCTATTTATTActtatcatttttttttcaggatgaAG ACAgaatatttacaaatttataTGGAAGACATGATTGGAAACTTAAAGGT GCAATGGCAAGGGTAGGTAACTAAATTGGTGTGCAGCATTATGTACCCAA TGTACTTCAGGGAAAATGGTTTCACCTTGATTGACTGATCATTACTTTTT AAagtgaatacaccttttcgaccgtagttgcGCGGTCAGCCGcatgccac ttaattatttaattatccccctaaactcgatccaagacacctttttctat tgtctctaggtgcgaaaaaaggattgggacggttttagtgggataaagta gacaaaaaaatgcctgcgtggcaattggtggctacggtcgaaaaggtgta tacatGTGTTAGACCAAACAACTGGTTATAATTCAGTGCCTATCTTAGCT ATACTTTAGCCCTAATCATTTAACATGTAAGCCCTTTCTCAGCTGTCAAT TATTAATAACTTTATAGGAAGCTTCgagattttctaaatttctgtTTAAT ATatatttggctggaattttatcACTTTTACACCATATAAGTGCTACCAG GGAACCAACAATAATACACATTTCGAGACAATTCTTATCATCAAAGGCTT ACTATAGTGCCAATATAGGAAAAGCACAATGACCTCAAATTTAACCACTT ATTAATGGAGGACTCACTCTTCCATTTTTCAGGGAGACTggtacaaaaca aaagaaattatagtCAAGGGTCATGATTGGATTCTTGATGAAATCAAAAC GTCAGGATTACGTGGACGTGGTGGAGCAGGTATATTGAACTTTTTGATTA TCAAATAATATTAGACATGGGGTTAAATGACAAAGTAGGCTACAACAAAT TTAGAttaacttttcttttctttctggcAAGAGCCAGTAAACCCTATAAA TTTTATAGAGAAAGctaatattcatgatatgcaccactgcaatgacttca cgaacaaattatgcaacttttctgtcgtttttttccacccaatacgtcat tttttctattgttaaaGTGACGTATTAGGTGGGATATTTTAAAAGtcctc agaagactctccagtggtgcatatcatgaattgaacgGCATTAGCGAAAT GCTAtttcaaaatacaatttttccaTCCCACAATTAGAGCGGAATGAAAA TTTCCATGCTATTATTGACTAACCTCAACCTTTAAATGaccaatattatt tttttgaacatttttgcaGTGTGACAaggaaattatttaaaactcATTTC TATGATAAAGTTgtaaatacactcttctcgagatgcataaatttattgtt gtcctcgttttcaaacagatttcgttgtaatgaaattatacatttaaacc aatttaaattcccaaaaggcaaacattaactctaaaacaaaagtacatga aattcaaaatgtctcatgagttgtaaacaacacaattatcattgtgaata tgcaattttatagcaatgaaatctgtttgaaaacgaggacaacaataaat ttatgcatctcgagaagagtgtatttgtatgttttattttttatatcatA GGTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGG TCGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTT GCAAAGATCGTGAAATTATGAGACATGACCCACACAAATTGGTAGAAGGA TGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACAT CCGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTAAGCTCTATAT TGTATACAGTTATATAatccaaaatgttgttttttgttgaaaacctCTAC AGGTCGCCTCTAAcccagtgaaaatttcaagcactcttttgtggcCGTTA TacggccaaaatactcaattttgAATTCAGTTTTAAAACTTTACTATGTG TCAGCAAAGTAGCAAGAATATGTAAGAAGGTGggcaaaatcaaatcaatc cttgaaaataaacttttcatCCAAGAAGTCTTTAGACAAATTTCCGTACT CCCAGattaaaaaaagaatctttGTTAAATCATTATAAGAAGTTTATTTA TTATTCTGAGGATAAGAGGATTATCGCAGTTGACTGACTATCTAATAGTA ATCACACAGTAATTTCATTCTTTGCTTTTACTTCTTAGGTTGCCATCAAC GAAGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATA CGATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCG AAGAAACTGTAAGTACTCTACCATAAGCATAAGATCTCGCCTTTTTGCTG TTTGCAGGTCAACATTTATATATGCTTGAGCTTTTTGGGAGAATATTCAA TAAAGCTGCCTCGTTTATGGAAACAAAGCAACAGACTCAATCATAGAAAG TTATTAATCAAACATATTCAAGTAGGGGAGATGTATTTTGTACCACTGTA TTTTAAACTCCTATCGCTTATGTTATCCTTCACTTTAGGCACTTATTGAA AGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGC TGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAAACTG TCGCCGTCGCTCCCGTAAGTTTACAATAACACACCTTTCAACCCTTGACG CCTAAAAGAGATAAGGCCTAAGATTACTTTGAAGGAATGACGGAGAAAAT CAAGGCAAGACTTCAGACGTCAACCCTACTTGGTAAAGATTAGTGTATAT TGATCAATAAAATTTGTGGAATGATCAATACAATTGAATGATTCTCTCGG ATAATTTTCCGTCACTTAAAAGTTCTAAATCTTGCGGAATTTTCGCATTT AATTTCCCCATTTGGTCAGGGAAACCAAATACTTGTAGTATCGCTTACAA AAGTTTATCTTTTCTCAAGCTTGTATCACATGCGCACAATAAATCATCCA TAACAAGTTTCCCGCAATATAATATGGCTGTGAGCACTGCTCTATAATCC TAAGAACTAAACTTTATGCGCCAACTTTGATTGAAGTTTTATTGAAAGTG GTGCCCGCAAACCctgggtatataaaggtcagtcgGAAATATCGCTCTCG GTACATTTTCACCGgtattgagtagtgctaccattatgGCCAGGGCTTAT AAAATGTCAGTTGCTGGGAGTTGAATAAAACTAATATTAAATAAGGACAA TTATTACTGCAAAATGCAACCGGTGCACTTATTATGACGTTATTTCTATA CGAATTATTATTCTTATACCATAGGAAATTTGCCGTCGTGGAGGAAGTTG GTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGGTAATCTCAG CCAGGGataaatattaaatgagcttttgaccGCGGCGATTGGCAATCGGT GAAAGCAATCGCCAAAATCAAACGTCAATCGTATACATAAACAATGTATA GACATTAGAACCGACTTGGTTTCTTTTGAAGTAAAAAACAACGCAGTTTT GATTGAtttggctgaacaaccaggtcagatctTCACATTCGCCATATCCC TTTAGACCAGAGTGTGGTATGCGCAGAATgaatgatctgttatgagataa gacaaaaggttgaaattgactaattaatttttgggaacaAAGTGTTTGTT ATGAAGTTGTTCCATCCTGTATCTTCTTATCTTGATAATCGActattcct tgggtgaataccggggggcgttttttttattttttgaaaattttcaattt taagggcttggtcacgagtttttgccaaaacgaggctaaaactttggggc aggctggagacttcaaaaatgatcagatttggccgaaattttgcacactt gatacTTGGGCGAATCCCTGGTGgcggttttttcattttttcaaaatttc cattttcaagggcgtggtcacgagtttttagttgaaattggttacaattt tacaattgggcctacgaatgatttaaaaacactgaagttgagcccagtgc ggttagcacgttcgacagtctTGATAATCGACtattagaccatgttcaca cgctACATATCCGTTTCGCTCTGAAACGAAATGAATCCACTCTATTGGCT AAATTCAAGTTTTAAATCACTTCTGACCaatttaaaatacattcattttG TTTTGGAGACGTAGCGTGTGATTCAGTTCagtttcatttcaaaacattcg aaatccCGCTGGTTGGCAACCAGAAAAGGAAACAACATGGTGTAGTCAGC TCTAAAACTGGACAAACTTCCTATCATAGAGGaagcccgatccagtcaag CGGTTAGGAATCAGTGATTTAAACcacataaattatttttctcttcttta gCTTTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAG AAATGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTC ACCGGTAAGAATCTTCTACAGTGATAAAAGTTCTTCTATCTCAGATGGAT TTCTAGCGAGCACCTCATTAataaccgggatttttcatctcgtttcttag tgagttccactttgacgatctTCGAAAAAtaaagcctttcaagtgttttg acgcaaattccatttttccctactgcaagggctttaaaatgacgtcaaaa aatcgaatgtttggagtccgaaaacctgggctcaaaacattcgaaaaagt tgcaaagtggaatagacgttaattgcgtagaaaaaacgcgggtgacatCT AGTATAGGCTAATGGATTATCGTCTCAGTGAAGTATATAAAGCTTTTTGC GTCTCAAGCttctgcataattcaccaaaacttcaagaatatgtgcttatt tgctgtgtaaaatccattttacGTCTCAGATGTGCaaaaaactttggttt aacCACGCCACGTCTTATTTTTCTGCAGCATTATAGCCTGTACCCGCGTA TAGTGCAGAGGGGTTCAAGGTCCGTTCCTAAAATTTTAGGGTCCACCACT TGAGTACTCCCACTTGATAGTTGATTTGCCAATCCTCGTAACAAGGGATT GAAATTTgacataaaattttgatttaaaaaaagctcTGTTCGtagacttt tttttctttcctccaTTTCAACTTGTGCTCAGGTAGGTAACTCTCAATAT AGAATTAGAGATTTTTCAGAGACTTTAAATTACATAGTTCGGAGAAAGTT CCTGctttaagaaatttttagaagCCACTTTTTTAGTCCCAACTAAGCCT ACCCCCTCCTCTCAAAGTTCTGAATTTCAAGGTCCCTGGTCAATTTAGgc ctaaaaaacaaaaaattacatttaaattcaaaattgaaaaacttgacTGA CTTGACACAAGTTCGATTAGCTACTACTGTAGAAGCTTAGAAAATCAAGA GTGACGTCAATAACGTGAATGTTTCGAGCCAAAGAACCTTGACTCTTGGA TAATACGCTACGGCATATGTAGAAAAAACCGAGACGTCTCGAAGAGGCTA TATTGTTTGTCACCAATAAGTCCTAATCTACCGCACACGAATTTACAAAC GTGTAACAAACACAACTGGGTTGTGACGTAATCAACATGGTCGTCGATTT CGGGTGGTCTCTTCTAGTACATTATCTAGCTTTAGCTTAAGGTTTAGTGA AAATGTGACCTCTGTAGTTTGTTTGTCGGTTTGTGTTTTATTTCAAGAAT ATATTTATAATCAGTTCCGAATATCGTGTTTCAATTTTATAGCTCTAAGG TTTATTTGATCTGAATTATTGTATAGTCTTATATAAAGATGATACGCAGG CAAATTTCCAgcgtttttatttcaaagattgaGTTTGAATTCAGTTCGAA GAACAAAATAATCAACCCAGGCTCTGTTTAATTAGTTGGGTActattaaa acacaaagaattaaccTTAGAATGGCCTTTTCTGTTAATTAGGGTCTAgg acatcaaatttttgtcaCGATTCTCATGGCTCAGGAAAGGCCTGTGAATT TGCCTGACACGTAATCTACAGTCGATTGCCAATTGGTGAATTCTGAAATT TCTTTTGCAGACTTTCTGTAGAAAGTTAGCGTTTTGTTCCTATGATATAC GTCGGAAATTAAGCAACGAGTTTCTAGTGCTTCCCGCGTTAGAATTATTT GCAAGACATTCTcagatttttttcttaaatcttTCTGTTGCATAACTTTC GCGTGTAATCTTTTACATCCAGAAACCTCCCGGTGTTGCTGTCAGCAGAA AGGTCAGACATAATAAAACTTCAAAGACACACAGACAGCTTTTGTTATTG CTCACTGCATGTCATCTTAGAACCTTCGTTTTAATCTGAGCTTTTAAACC TAGTGATTAAAATTGTTTCCTTAtttttctgtgagattgcataACTAGAC CCAAGAAGCATAGAAGTTATTACAGAACGCAAAATTGTTCGAGCTCAGAA AATTTCGAGTTTTGGTGCAATaataaggtattgttaactgaaaatCACGT AAAGCTTCTTCGAGTTAGGGAAACATTACAGTTAAAGAGGTAGATTACtg taatttctttaaaaatctaaagaatcctaTTGTTACAAATCTTCTTGATC AGAGTTACATAAGACAAGTGTTAGTCAGCAAGAACATGTGACAATCACTG CTAAGCTCTATGCCAAGCTCCTCCTCCACTATTTTCATTTAAGAAGTGCT TTCCATCTTTCCTTTGGCAACATATGAGATCCGCTACATCAGCAGTTTGT AAACTGACTAATCCGGATGTATTTTTTCGTACATCATTTCTGCTGATTCT GCAATTTAAAgttgattttacattttctttttttgccatgTTTTACCATC CTTGACATCCTACTGTTTTATGAATATGGCGCCAGAAATACTTTAACTCT GGCCTCCTTGAAATCAGAGCAATACGTTGACACCTTCCCGAAATGTCGCA ATGTTCATGACGTATTTTTAGTAACGAAGACAACCGGAATTTCCAGTTAT CTAGAAATTCCACTGCTTTATCATTCAATNATTTTAGTAACGAAGATAAC CGGAATTTCCAGTTTGCTATAAATTCCTCTGCTTTATCATTCAAACTTCA CGAGAAACGCTCAGTTTTTCGGTATCCCTCTACATAAAAGAATTGTGATT GACCCTTTAAACGATCATTGTAATGACTAGTCTCTTAAGTGTTGTTATTT TTGGAAACAAGGGGAATCTATACACCCTATAAACACCCCCTTACTTCGTT atatattgtatattttttgtttaagaaTATGGAGCCGTTTTCTAGTTGAA CGACGCAAGTGATCTAAAGATCAAGTAGCTAATAATTGAAAAATAGGTTC TACAATTGCTTCAATAAAACTGTTCATATTAAGATTAGAGCATTAGCCAG CCTTAAAACTCTTACCATTGGGACTGTGTGAAAgccatttttatgttttt tgtgtTTGTTGGAAATCTCGAAACGAGGTAGCAAGAAATTCGGATACAAA TGACAGTCGACTTATGACAATATGTcctaaatgaacaaaaaatgcCTTAA GTACAGTAGAAACTACTATGTAACCCTTAATCATGTTAACTATACCGATC TGGTCAAAGGGATTCGAACAGTTTTTCTCGTCAGCTTTTTCTCAGGCATT TCTCGAACAATGTGATAGGTCTGTTGCTGAAGACATTCTTCTCACTGATC GTCTATATTTAGTTTTAATCTAGGCTAGACTGTTACTAGTCTAGTAAACC CTCCTTCTACAAGACATGCTATTGTCCAGAGTAAAATTGTGAGCAAGTAA TTACTACACTCACAAGAACAGAAGACGGCGGTTGATAcaatttcttacaa aaaaatgttCATGTACAAAATCAAATCTTTTGTTATTTGTTCAAACAACA AGAAAGATGAGAAAATattccataaaaaaattatcgagTGTGACACAAGA AAgtcattttttatgagaaaaacatttttagtcaaGTGTTGACATAAAGA TTAATGACAGAATGGAGAGAGAGAAAACACCGGTCAGCTAACGTACAGCC ACTAAGTGATTCTTAGGTTACAACAAGAGACAGTATATAAAGAGGTGGCT GAGTGTTGGTTCGAGTTTCAAAACCATACCAATTGAACTGCGAGACGGTC AGTCTTTTTTACTGCAGAGAACGAGGACTGTTCTGACcagaaaacaaaaa catgcaTTGGTTAGCCTGTGTTGTTTTAACCATTTTGGTTATCGACCGAA TCCAGGCTACTGAATTACCTGAAGAAAACCTATTGGTTCCGGACTTGATT GAATATTGGGGATATCCTGCCGAATCGCATGAAGTCCAAACCAAAGATGG CTACCTGTTGACTTTACACCGTATTCCGTATGGTAAAGGACATACGGACA CAACCCGGAAACGACCGGTATTCTTTTTACAACACGGACTCCTTTGTAGT AGCTCGAATTGGGTTACCAACCAACCACACTTGTCTCTTGGATTCATGCT CGCTGACTCTGGTTATGACGTATGGATGGGTAATAATCGAGGCAATACTT ACTCCAAGAAACACGTGACTTTACCGGTTGACAGCAAGGCATTCTGGGAT TTCTCGTTCCAGGAATTCGCAAAATATGACATGCCCGCCATGTTGGGGTA CGCCTTAAATGTGACCGGAAATAAACAATTGTACTACGTCGGACACTCTG AAGGCACCATGATGATTTTCGCCGGTTTGAGTGAAAGTGAGGAGCTACAG AAAATGATTAAGACAGCCTTTGCACTAGCCCCTGTCGCGCATCTGGATAA AGCCTCATCGCCTATTACTTATCTATCATCTTTCGAAACTGAAATTGGAG GATTTTTCGGTTTTCTCGGCGTCCGTGAGTTTATGGCTTCTAGCTACTGG ATACGTAAACTAGCTGACTTGACTTGCTCTTTCGATGAGGGCGCCCTTTG TGGAAACTTCCTTTTCTTGATTGCCGGTTCAGACAGTCGAAACATGAACG CCACTCGCACGCCCATCTNTTCTTGATTGCCGGTTCAGACAGTCGAAACA TGAACGCCACTCGTACGCCCATCTATTTCACACACACGCCCGCTGGAACA TCAGTTAAAAATATGCTTCATTTCTGCCAGCTCATCGAAGCAGGGCGTTT CCAAAAGTACGACTATGGGTGGGCGAAGAATCTTTACCACTACCACTCAT TGAAGCCTCCTCAATACCcaatcaaaaacatcaaaacggAAATCGAATTT TTCTCTGGGGGACGAGATACCCTCGCTGACCCTCAAGACGTTTCATGGTT GACTACGCAAGTTAAAAGTCTCACCAAACATCACGTTATCCCGGAATACA ATCATTTAGATTTCATTTGGGGCGAATCAGCACGCCGTAAGGTCtataag aaaatcattaaatctGCTTATCGTAAAGATGGCATTTTACGACGATAAAT CATTTCTTTTTGTGACTGGCAGAAAACTGTTTTTGATTGGATGAAACTTG TTGAAAAAGTAGATATAATCAACGGACAAGACTTTGATATCATGTTGCGG ACAATATTTAAATGGTACAAAAAAAACGAATTGCAAAACTCTACGATCTC ctacaaatatttttgtttctgtgGTAGTTGGTTCCCTGTAATATGTTTTT GCACCAACATTAGATGTATAATGTATGTTAAAAAAGTATTATAAAAGTAT ATTgaataaaaggaaaattaagGAGGAAAGCTTCGccacttttataaaaa tctttaTCGCAACTCCCTTGAAGTAGACCTGAAAATATTGTCACTTTCCC CCCGACAAATCTTTCCCCTTTAAGGTACAGTACTTTTAAACATACGTTGT GATCCcttattttcaagtttttttcacACTGATTTCACATACAAGTTCCG ctcttcaaaaataaattacagTGCATAACTCGAACAACATCACGAGGAGC GCAAATTTGTTCGgtttatggaaatttcgagttagaAGATGAGATtggtt tataaggtattgttaactaaagagaccagaaaacttgttcgagttaagga gatattcgagttatagaaattcgagttatggagctGCCACTCTATGATAC GATGATGCGAGATTTGTAAGCCCTTTTCTAATGTCATGATAGATCTCATC TTTCGGGTGTCTCCTTTCTTTACTTTTGgattgattttcgaaaaaatttc gtaATCCTAGAAATGGGTAACGAACGTGTCTGTCAGTGCCCTtgtaaaat tatatattttgaaaaataattttcttacatCAAGAGTCTATTTCGAGAGT CTTTTTACTCCTTTTTTTTGTTAGAACAATTAGGCTCAAAACGAATTCag cataagaaaaaatttgtctcaaagtatcaaataaaacaaaaacagccAAG CCTTAACAAAAATGTGTAGTTTGggtcttccagaaaaaattggaATATGG AGCGTGGAGGatataacttttttttcgaaatttaaccaacgaacattgtg acttttgactcGCCGGACAACAGGTCTAACTTCCCGAACACCACCATCAG TTGATCCCGGACAttcaaattacccccaaacagagcaagtttcccccccc ccccggacaaggcacattttgtagatttttcaccaCCCCCCTTGGACAAT TATATCCTCTACTCAACATGTACAAACTGGAATGACCCGTTCTTATAGTA TTGTAATGTACAGGCTTGCAATAGACATCACTTACCCCTTTACACTCCTT CGTCATTTAGTTGTCACTTGTCAACTCTTGTTTGAGTTTAGACAGCAAAC AATATCAATTATTTACATTTATCACATATTTGCGAAGGGGCTTTCGAGCA CCAAGGAAGCTAAAGATCTAAATCCTGTCTTAAGTGATTTTTCATCTCTT TGATTTGATcaaattttccccttttttgtTTACCCTGGAATAAGGCTGTT GTGcatgttttgttttaaaaaccaGGCtagtttgagggtaattttgaacg TCCAGGGTCAACTGTTGCTTGTTCGGGgagttagacctgctgtccggcga gtcaaaagtcaaaattgTCTTTTCTTAAGATATTGTTTTTTGATTCGTAG GTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCA CTCATCCCTATAGAGTAAGTAGTGTTCACACACGTGCATTATTTTATTTC AACTCCTATTTTTGGTTTACGACAAAAGGTCTGTTTTTTGTCGTGGatca aattttacattttaatgtcAATATTGCTTGTACTTCTCTATCTCTGTAAA CTTTTAACCTGGGAGAGGTGGGGGCACTGAACTTGACAGCCGACGGGGAC CTGCTGTATGAGtctgaaaagtggaccctgtcggATATGAATATAGGATA TATCGActttttcaccctgaaaagtggtgaaaatgactaaaattagACGA CTAATTTTGACCCTGAAAAATAACCAAAGTCGACTGAACACGCTCAATTA AAATAGTTAGAGATCAGCGAATTAAACATTAAAATTATGTTCTCTTTCTG TGTACAGTGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGA GCACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGGT ATAAAGCTATTTGATATTTGCAGTGCTTTATGGGTAACTTTGACTCGGCG CAAATCATGAGGGCTTGTACTGTTTTAAAATACTTATGCAATCTCGTTTT AAAATCACTCAGGAAAATCGGGTCGAGGCTCAATATGCTTAGACttcgat ttgttgattttctttgggttcatgaaagtcggaaaattgattcgATTCAA GGaatgaaagttttgaaaaagtaaccCTTAGAAAGGTCAGCGTTTCAGTA AAGCTACACGAATTTTTTCGTATTTCAGCTTAGCtcattatgcttatttt ttaccgaCTTTGCGCCTAAGTATGCTtaaaacgttatgcttataaaaaaa gtgtatattcATAAGACAAGAAATATAGAAGCAAGATTCTATTCTCTGCA TTCACAAAGCCATTGTCCCCATTTCCTTAATGACACTGTGGATTAGTCTT ACTGGTGATGTATTGATAGAGCTCAAacgttaatttttgaaaaataactt ctTTTTTTCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTTT TACAAACACGAAAGTTGTGGACAGGTAAGATTGAAGCTTTGAAATGAATA CttgggggtactaggtttgcgagatgacgcGAATGTCCGGACCAAAGATc taaaatcgacccttagagagactgaatttcggaaatttcgtccatttttt aacgtttttgccaccttagagagactttctcccaaaatttcagccaaaaa tttCTAATATCCCTTTCAGGgagtcgattttttattttcgccaacATACG AAAGGCTCGCACATATCCATTTTACCTAAGTACCTGGATGAATACTGACC TCCCTTACTGTCAAGTCGTGCATTTTGATTATTGAAGTACACATTAgcag cgcttctttgatgccagtaaacattcaaaaagatttttgttttaaaaata ctCCGCGGATAAAGCCTTTCCGAATTCTCATTGGGGATCAATCTTGCGGA TGACAACCAAACCCTCAAAATTTTATCCGATTGAAGTAAATCGACTTCTA TCTTTCGAACAATTTGTCTGACCCCTTTATCAGTAACCAAACCAATGTAA ACCAATTGTAAACCAATCATGGTAACtcaaaacaaatttattgagttcCC CGTCCTTGTTCGAGTTAAGTATAGAGGCTAGATGTTcttatttctctttt tattcattcaaaaaaattagtgTACACCATGTCGCGAGGGAGTTGGATGG ATGAACAAAATCATGGCTCGATTCGGTAAGCATCTTCATACATTTGTATA CCTGCAGCTAGAGTTTTTGTGAACTTCTAACGTGAGCTTGTCTGTCAAGC AATCAAACCTTCACCCCCTATTATCCAGTTTTAGGGCCAAAAGCCTCCCC GATTCCAAATTGATGCGCGTTTTAAAACAACCACACCATGGAACTTCACT CATTTTTTATATGGAGTTGGGTGAGCCTTTAAGTTTTTGGAATCCTGCAG CATTTTAAGTATTGATTTCCTAGGAATGGAAATGGAGTTCCAACAAGGGG TATATAGTTTATTTCTGGAATgtggaaaagcccaattcacTCTCAAATAC TGAtagtcaaaacatttttttagtattttaaatTTGACGGTATTTTGCAA AGAATGGTAGGCTTTTTCTTGACGaatgttatatttttattttcagtcgA AGGAAAAGCTAAACAGGGAGAAATTGATATGTTATGGGTAAGTCATCAAA TGTTTCATTGTTTTATAACTTATCGCCGCGAGTATAGCACTTTCAACCAT ATATTAACCTCGAGAATTATTATAATCGATCAGTGGATTTCTATTTATAG GGAACTTAATCGCTTGAGCCACTTGTGAAAGAAAATACCGAACAGTTGAG CTCTTCATCTTTTCACCGAGAATTATTGAAACATGATAATGGTTCCACGG TTGACTATTTTTTCGATTTATTCCTATTTCGATATTATCATATAATGTGG AATTTATTTTTGCGTTTTGCAGGAAGTGAGCAAACAGATCGAAGGACATA CAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGTAAGTTCT CATTGATGATGTTTCAACTTGTTTTTacacattttataagaacaatttta taagaatgaggCTCAAGatcgccaaaaaaataagaacactttaagaacaa tgctgaggctgaaattactcaatttcaatcaattttggGGTCGCAGTaGT ATAAagtataacgcctaaaatacctcacttGCATCAAGAACAGCCGAAcc gcagcaaaattttactggttcttataaaaaaattgtaatgtGATTATATA AATCTATTAAGATTGGAATTgcacaaagaaaaaatgttaTACGTTCATAT GCTTTTTTATGTTATGAGCTTAATCTTTGTTTTTACGGGGTAAAAATCTA TATTTCCAAGTTGGTTGGTCGGAATTTAGCCCCGTGTACTTCTAAAATTG TTCCTGTAGAAATAAGTATTTGGAGCGAGAAAATTATGCAATAAAAATTC TCTGTTGATTTAAAACTAGACTAgcgtctacttctgactgaactttgctt tttgatgattttgatggcgctTAGTCCAGTGAAATAGACTAGGGGATTTc gccatttttaaaatttttcacttttttttcaaaattagaagaaaacGATA TATTCAAAAACCCcatcaaagtttatgaaactataataaaaaaattagaa atacatcaaaaatttgaagaaaaacaattgGTCTATTGGTCATTGTTTTc tgttggtttttttttttttggttttttgaaagtcgtcgttctttttgtct atttttaataAACGTAGGGTTCTTTAGATTAAACCCCCTCCTTTCTTTTA TTTACAGGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGA ACCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAATAC TTTAttattaataaaatattgaatattgatCAAATGTATTTTCTATCTAT CTATCATCTCTATCTCTCGACTAATTGCGATGGTTTCAAAACTCGAAGTG TAAATAAGTTActgtattatttttttgtttttgctca

Coding sequence (CDS) from alignment at sc0000001:107381..124517+

>TCONS_00000004 ID=TCONS_00000004|Name=|organism=Clytia hemisphaerica|type=CDS|length=21792bp|location=Sequence derived from alignment at sc0000001:107381..124517+ (Clytia hemisphaerica)
AGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGACAC
AaaatcataTGGACCACTCAAGgatgaAGACAgaatatttacaaatttat
aTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGAGACTgg
tacaaaacaaaagaaattatagtCAAGGGTCATGATTGGATTCTTGATGA
AATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCCCTACTG
GATTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCAAAATAT
CTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGATCGTGA
AATTATGAGACATGACCCACACAAATTGGTAGAAGGATGCCTGGTAGCTG
GCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGTGAATTT
TATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATACAAAGC
TGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCGATGTTT
ACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACTGCACTT
ATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATT
TCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTG
AAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGTTC
GTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAACATCTC
TGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTATCCCAT
TGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGATGGGAC
AACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCACTCATCCCTAT
AGATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGAGCAC
AAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGAGCGAC
ATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGAAAGTTG
TGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACAAAATCA
TGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGATATGTTA
TGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCTCGGTGA
CGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGACCAGTAC
TGGAAGCCCGTATGAACCAATATCAAGACGATTTCGATACAAAAGTGGCT
GCTGCTGTCTAAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACA
ATCAACAGACACAaaatcataTGGACCACTCAAGgatgaAGACAgaatat
ttacaaatttataTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCA
AGGGGAGACTggtacaaaacaaaagaaattatagtCAAGGGTCATGATTG
GATTCTTGATGAAATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAG
GTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGGT
CGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTG
CAAAGATCGTGAAATTATGAGACATGACCCACACAAATTGGTAGAAGGAT
GCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATC
CGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGA
AGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACG
ATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAA
GAAACTGCACTTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATT
GAAGCCTCCATTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCG
TCGCTAACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGA
GGAAGTTGGTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCT
TTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAA
TGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACC
GGTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACC
ACTCATCCCTATAGATGTCTGCAGTGACGTCATGATGGATTTCGACGACT
TAGTTCGAGCACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAAC
AAGCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAA
ACACGAAAGTTGTGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGA
TGAACAAAATCATGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAA
ATTGATATGTTATGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTG
TGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATT
TCCGACCAGTACTGGAAGCCCGTATGAACCAATATCAAGACGATTTCGAT
ACAAAAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCATTGGCTATCTC
GAAATGTTTACAATCAACAGACACAaaatcataTGGACCACTCAAGgatg
aAGACAgaatatttacaaatttataTGGAAGACATGATTGGAAACTTAAA
GGTGCAATGGCAAGGGGAGACTggtacaaaacaaaagaaattatagtCAA
GGGTCATGATTGGATTCTTGATGAAATCAAAACGTCAGGATTACGTGGAC
GTGGTGGAGCAGGTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAA
CCAGATGACGGTCGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGA
GCCAGGCACTTGCAAAGATCGTGAAATTATGAGACATGACCCACACAAAT
TGGTAGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCT
TATATATACATCCGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGT
TGCCATCAACGAAGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTG
GAAGTGGATACGATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTAC
ATTTGTGGCGAAGAAACTGCACTTATTGAAAGTTTAGAAGGTAAACAAGG
AAAGCCACGATTGAAGCCTCCATTTCCAGCTGACGTCGGTGTTTTCGGAT
GTCCCACCACCGTCGCTAACGTTGAAACTGTCGCCGTCGCTCCCGAAATT
TGCCGTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCTCACGAAACTC
AGGACAAAAGCTTTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCG
TCGAAGAAGAAATGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCT
GGTGGTGTCACCGGTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGG
ATCATCTACACCACTCATCCCTATAGATGTCTGCAGTGACGTCATGATGG
ATTTCGACGACTTAGTTCGAGCACAAACAGGCCTTGGAACGGCTGCCATC
ATCGTTATGAACAAGCAGAGCGACATCGTCCGTTGCATTGCACGTCTCAT
AGAGTTTTACAAACACGAAAGTTGTGGACAGtgTACACCATGTCGCGAGG
GAGTTGGATGGATGAACAAAATCATGGCTCGATTCGtcgAAGGAAAAGCT
AAACAGGGAGAAATTGATATGTTATGGGAAGTGAGCAAACAGATCGAAGG
ACATACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCT
TGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGAACCAATATCAA
GACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTC
ATTGGCTATCTCGAAATGTTTACAATCAACAGACACAaaatcataTGGAC
CACTCAAGgatgaAGACAgaatatttacaaatttataTGGAAGACATGAT
TGGAAACTTAAAGGTGCAATGGCAAGGGGAGACTggtacaaaacaaaaga
aattatagtCAAGGGTCATGATTGGATTCTTGATGAAATCAAAACGTCAG
GATTACGTGGACGTGGTGGAGCAGGTTTCCCTACTGGATTAAAATGGAGT
TTCATGAACAAACCAGATGACGGTCGTCCAAAATATCTCGTTGTCAACGC
TGACGAAGGTGAGCCAGGCACTTGCAAAGATCGTGAAATTATGAGACATG
ACCCACACAAATTGGTAGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGC
GCCCGCGCCGCTTATATATACATCCGAGGTGAATTTTATAACGAAGCGTC
TAACATGCAGGTTGCCATCAACGAAGCATACAAAGCTGGTTTCCTTGGTA
AGGATGCATGTGGAAGTGGATACGATTTCGATGTTTACATGCACCGTGGT
GCAGGAGCGTACATTTGTGGCGAAGAAACTGCACTTATTGAAAGTTTAGA
AGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGCTGACGTCG
GTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAAACTGTCGCCGTC
GCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCG
CTCACGAAACTCAGGACAAAAGCTTTTCAACATCTCTGGCCACGTGAACA
ACCCGTGTACCGTCGAAGAAGAAATGTCTATCCCATTGAAAGAGCTCATC
GAACGACACGCTGGTGGTGTCACCGGTGGATGGGACAACTTGCTGGCCAT
CATCCCCGGTGGATCATCTACACCACTCATCCCTATAGATGTCTGCAGTG
ACGTCATGATGGATTTCGACGACTTAGTTCGAGCACAAACAGGCCTTGGA
ACGGCTGCCATCATCGTTATGAACAAGCAGAGCGACATCGTCCGTTGCAT
TGCACGTCTCATAGAGTTTTACAAACACGAAAGTTGTGGACAGtgTACAC
CATGTCGCGAGGGAGTTGGATGGATGAACAAAATCATGGCTCGATTCGtc
gAAGGAAAAGCTAAACAGGGAGAAATTGATATGTTATGGGAAGTGAGCAA
ACAGATCGAAGGACATACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGC
CAGTACAAGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATG
AACCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAAAG
CGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGACACAa
aatcataTGGACCACTCAAGgatgaAGACAgaatatttacaaatttataT
GGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGAGACTggta
caaaacaaaagaaattatagtCAAGGGTCATGATTGGATTCTTGATGAAA
TCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCCCTACTGGA
TTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCAAAATATCT
CGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGATCGTGAAA
TTATGAGACATGACCCACACAAATTGGTAGAAGGATGCCTGGTAGCTGGC
CGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGTGAATTTTA
TAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATACAAAGCTG
GTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCGATGTTTAC
ATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACTGCACTTAT
TGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTC
CAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAA
ACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGTTCGT
TGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAACATCTCTG
GCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTATCCCATTG
AAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGATGGGACAA
CTTGCTGGCCATCATCCCCGGTGGATCATCTACACCACTCATCCCTATAG
ATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGAGCACAA
ACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGAGCGACAT
CGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGAAAGTTGTG
GACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACAAAATCATG
GCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGATATGTTATG
GGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCTCGGTGACG
GTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGACCAGTACTG
GAAGCCCGTATGAACCAATATCAAGACGATTTCGATACAAAAGTGGCTGC
TGCTGTCTAAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAAT
CAACAGACACAaaatcataTGGACCACTCAAGgatgaAGACAgaatattt
acaaatttataTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAG
GGGAGACTggtacaaaacaaaagaaattatagtCAAGGGTCATGATTGGA
TTCTTGATGAAATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGT
TTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCG
TCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCA
AAGATCGTGAAATTATGAGACATGACCCACACAAATTGGTAGAAGGATGC
CTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCG
AGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAG
CATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGAT
TTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGA
AACTGCACTTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGA
AGCCTCCATTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTC
GCTAACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGG
AAGTTGGTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTT
TCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATG
TCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGG
TGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCAC
TCATCCCTATAGATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTA
GTTCGAGCACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAA
GCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAAC
ACGAAAGTTGTGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATG
AACAAAATCATGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAAT
TGATATGTTATGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTG
CCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTC
CGACCAGTACTGGAAGCCCGTATGAACCAATATCAAGACGATTTCGATAC
AAAAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCATTGGCTATCTCGA
AATGTTTACAATCAACAGACACAaaatcataTGGACCACTCAAGgatgaA
GACAgaatatttacaaatttataTGGAAGACATGATTGGAAACTTAAAGG
TGCAATGGCAAGGGGAGACTggtacaaaacaaaagaaattatagtCAAGG
GTCATGATTGGATTCTTGATGAAATCAAAACGTCAGGATTACGTGGACGT
GGTGGAGCAGGTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACC
AGATGACGGTCGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGC
CAGGCACTTGCAAAGATCGTGAAATTATGAGACATGACCCACACAAATTG
GTAGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTA
TATATACATCCGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTTG
CCATCAACGAAGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGA
AGTGGATACGATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACAT
TTGTGGCGAAGAAACTGCACTTATTGAAAGTTTAGAAGGTAAACAAGGAA
AGCCACGATTGAAGCCTCCATTTCCAGCTGACGTCGGTGTTTTCGGATGT
CCCACCACCGTCGCTAACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTG
CCGTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCTCACGAAACTCAG
GACAAAAGCTTTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTC
GAAGAAGAAATGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGG
TGGTGTCACCGGTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGAT
CATCTACACCACTCATCCCTATAGATGTCTGCAGTGACGTCATGATGGAT
TTCGACGACTTAGTTCGAGCACAAACAGGCCTTGGAACGGCTGCCATCAT
CGTTATGAACAAGCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAG
AGTTTTACAAACACGAAAGTTGTGGACAGtgTACACCATGTCGCGAGGGA
GTTGGATGGATGAACAAAATCATGGCTCGATTCGtcgAAGGAAAAGCTAA
ACAGGGAGAAATTGATATGTTATGGGAAGTGAGCAAACAGATCGAAGGAC
ATACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTG
ATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGAACCAATATCAAGA
CGATTTCGATACAAAAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCAT
TGGCTATCTCGAAATGTTTACAATCAACAGACACAaaatcataTGGACCA
CTCAAGgatgaAGACAgaatatttacaaatttataTGGAAGACATGATTG
GAAACTTAAAGGTGCAATGGCAAGGGGAGACTggtacaaaacaaaagaaa
ttatagtCAAGGGTCATGATTGGATTCTTGATGAAATCAAAACGTCAGGA
TTACGTGGACGTGGTGGAGCAGGTTTCCCTACTGGATTAAAATGGAGTTT
CATGAACAAACCAGATGACGGTCGTCCAAAATATCTCGTTGTCAACGCTG
ACGAAGGTGAGCCAGGCACTTGCAAAGATCGTGAAATTATGAGACATGAC
CCACACAAATTGGTAGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGC
CCGCGCCGCTTATATATACATCCGAGGTGAATTTTATAACGAAGCGTCTA
ACATGCAGGTTGCCATCAACGAAGCATACAAAGCTGGTTTCCTTGGTAAG
GATGCATGTGGAAGTGGATACGATTTCGATGTTTACATGCACCGTGGTGC
AGGAGCGTACATTTGTGGCGAAGAAACTGCACTTATTGAAAGTTTAGAAG
GTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGCTGACGTCGGT
GTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAAACTGTCGCCGTCGC
TCCCGAAATTTGCCGTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCT
CACGAAACTCAGGACAAAAGCTTTTCAACATCTCTGGCCACGTGAACAAC
CCGTGTACCGTCGAAGAAGAAATGTCTATCCCATTGAAAGAGCTCATCGA
ACGACACGCTGGTGGTGTCACCGGTGGATGGGACAACTTGCTGGCCATCA
TCCCCGGTGGATCATCTACACCACTCATCCCTATAGATGTCTGCAGTGAC
GTCATGATGGATTTCGACGACTTAGTTCGAGCACAAACAGGCCTTGGAAC
GGCTGCCATCATCGTTATGAACAAGCAGAGCGACATCGTCCGTTGCATTG
CACGTCTCATAGAGTTTTACAAACACGAAAGTTGTGGACAGtgTACACCA
TGTCGCGAGGGAGTTGGATGGATGAACAAAATCATGGCTCGATTCGtcgA
AGGAAAAGCTAAACAGGGAGAAATTGATATGTTATGGGAAGTGAGCAAAC
AGATCGAAGGACATACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCA
GTACAAGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGAA
CCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAAAGCG
GAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGACACAaaa
tcataTGGACCACTCAAGgatgaAGACAgaatatttacaaatttataTGG
AAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGAGACTggtaca
aaacaaaagaaattatagtCAAGGGTCATGATTGGATTCTTGATGAAATC
AAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCCCTACTGGATT
AAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCAAAATATCTCG
TTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGATCGTGAAATT
ATGAGACATGACCCACACAAATTGGTAGAAGGATGCCTGGTAGCTGGCCG
TGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGTGAATTTTATA
ACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATACAAAGCTGGT
TTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCGATGTTTACAT
GCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACTGCACTTATTG
AAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCA
GCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAAAC
TGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGTTCGTTG
GTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAACATCTCTGGC
CACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTATCCCATTGAA
AGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGATGGGACAACT
TGCTGGCCATCATCCCCGGTGGATCATCTACACCACTCATCCCTATAGAT
GTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGAGCACAAAC
AGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGAGCGACATCG
TCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGAAAGTTGTGGA
CAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACAAAATCATGGC
TCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGATATGTTATGGG
AAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCTCGGTGACGGT
GCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGACCAGTACTGGA
AGCCCGTATGAACCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTG
CTGTCTAAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCA
ACAGACACAaaatcataTGGACCACTCAAGgatgaAGACAgaatatttac
aaatttataTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGG
GAGACTggtacaaaacaaaagaaattatagtCAAGGGTCATGATTGGATT
CTTGATGAAATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTT
CCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTC
CAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAA
GATCGTGAAATTATGAGACATGACCCACACAAATTGGTAGAAGGATGCCT
GGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAG
GTGAATTTTATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCA
TACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTT
CGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAA
CTGCACTTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAG
CCTCCATTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGC
TAACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAA
GTTGGTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTC
AACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTC
TATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTG
GATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCACTC
ATCCCTATAGATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGT
TCGAGCACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGC
AGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACAC
GAAAGTTGTGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAA
CAAAATCATGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTG
ATATGTTATGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCC
CTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCG
ACCAGTACTGGAAGCCCGTATGAACCAATATCAAGACGATTTCGATACAA
AAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCATTGGCTATCTCGAAA
TGTTTACAATCAACAGACACAaaatcataTGGACCACTCAAGgatgaAGA
CAgaatatttacaaatttataTGGAAGACATGATTGGAAACTTAAAGGTG
CAATGGCAAGGGGAGACTggtacaaaacaaaagaaattatagtCAAGGGT
CATGATTGGATTCTTGATGAAATCAAAACGTCAGGATTACGTGGACGTGG
TGGAGCAGGTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAG
ATGACGGTCGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCA
GGCACTTGCAAAGATCGTGAAATTATGAGACATGACCCACACAAATTGGT
AGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATA
TATACATCCGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTTGCC
ATCAACGAAGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAG
TGGATACGATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTT
GTGGCGAAGAAACTGCACTTATTGAAAGTTTAGAAGGTAAACAAGGAAAG
CCACGATTGAAGCCTCCATTTCCAGCTGACGTCGGTGTTTTCGGATGTCC
CACCACCGTCGCTAACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTGCC
GTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCTCACGAAACTCAGGA
CAAAAGCTTTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGA
AGAAGAAATGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTG
GTGTCACCGGTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCA
TCTACACCACTCATCCCTATAGATGTCTGCAGTGACGTCATGATGGATTT
CGACGACTTAGTTCGAGCACAAACAGGCCTTGGAACGGCTGCCATCATCG
TTATGAACAAGCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAG
TTTTACAAACACGAAAGTTGTGGACAGtgTACACCATGTCGCGAGGGAGT
TGGATGGATGAACAAAATCATGGCTCGATTCGtcgAAGGAAAAGCTAAAC
AGGGAGAAATTGATATGTTATGGGAAGTGAGCAAACAGATCGAAGGACAT
ACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTGAT
CCGTCATTTCCGACCAGTACTGGAAGCCCGTATGAACCAATATCAAGACG
ATTTCGATACAAAAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCATTG
GCTATCTCGAAATGTTTACAATCAACAGACACAaaatcataTGGACCACT
CAAGgatgaAGACAgaatatttacaaatttataTGGAAGACATGATTGGA
AACTTAAAGGTGCAATGGCAAGGGGAGACTggtacaaaacaaaagaaatt
atagtCAAGGGTCATGATTGGATTCTTGATGAAATCAAAACGTCAGGATT
ACGTGGACGTGGTGGAGCAGGTTTCCCTACTGGATTAAAATGGAGTTTCA
TGAACAAACCAGATGACGGTCGTCCAAAATATCTCGTTGTCAACGCTGAC
GAAGGTGAGCCAGGCACTTGCAAAGATCGTGAAATTATGAGACATGACCC
ACACAAATTGGTAGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGCCC
GCGCCGCTTATATATACATCCGAGGTGAATTTTATAACGAAGCGTCTAAC
ATGCAGGTTGCCATCAACGAAGCATACAAAGCTGGTTTCCTTGGTAAGGA
TGCATGTGGAAGTGGATACGATTTCGATGTTTACATGCACCGTGGTGCAG
GAGCGTACATTTGTGGCGAAGAAACTGCACTTATTGAAAGTTTAGAAGGT
AAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGCTGACGTCGGTGT
TTTCGGATGTCCCACCACCGTCGCTAACGTTGAAACTGTCGCCGTCGCTC
CCGAAATTTGCCGTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCTCA
CGAAACTCAGGACAAAAGCTTTTCAACATCTCTGGCCACGTGAACAACCC
GTGTACCGTCGAAGAAGAAATGTCTATCCCATTGAAAGAGCTCATCGAAC
GACACGCTGGTGGTGTCACCGGTGGATGGGACAACTTGCTGGCCATCATC
CCCGGTGGATCATCTACACCACTCATCCCTATAGATGTCTGCAGTGACGT
CATGATGGATTTCGACGACTTAGTTCGAGCACAAACAGGCCTTGGAACGG
CTGCCATCATCGTTATGAACAAGCAGAGCGACATCGTCCGTTGCATTGCA
CGTCTCATAGAGTTTTACAAACACGAAAGTTGTGGACAGtgTACACCATG
TCGCGAGGGAGTTGGATGGATGAACAAAATCATGGCTCGATTCGtcgAAG
GAAAAGCTAAACAGGGAGAAATTGATATGTTATGGGAAGTGAGCAAACAG
ATCGAAGGACATACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGT
ACAAGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGAACC
AATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAAAGCGGA
AGACTTTCATTGGCTATCTCGAAATGTTTACAATCAACAGACACAaaatc
ataTGGACCACTCAAGgatgaAGACAgaatatttacaaatttataTGGAA
GACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGAGACTggtacaaa
acaaaagaaattatagtCAAGGGTCATGATTGGATTCTTGATGAAATCAA
AACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCCCTACTGGATTAA
AATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCAAAATATCTCGTT
GTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGATCGTGAAATTAT
GAGACATGACCCACACAAATTGGTAGAAGGATGCCTGGTAGCTGGCCGTG
CCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGTGAATTTTATAAC
GAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATACAAAGCTGGTTT
CCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCGATGTTTACATGC
ACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACTGCACTTATTGAA
AGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGC
TGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTAACGTTGAAACTG
TCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGTTGGTTCGTTGGT
ATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAACATCTCTGGCCA
CGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTATCCCATTGAAAG
AGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGATGGGACAACTTG
CTGGCCATCATCCCCGGTGGATCATCTACACCACTCATCCCTATAGATGT
CTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTCGAGCACAAACAG
GCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAGAGCGACATCGTC
CGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGAAAGTTGTGGACA
GtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACAAAATCATGGCTC
GATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGATATGTTATGGGAA
GTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCTCGGTGACGGTGC
TGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGACCAGTACTGGAAG
CCCGTATGAACCAATATCAAGACGATTTCGATACAAAAGTGGCTGCTGCT
GTCTAAAGCGGAAGACTTTCATTGGCTATCTCGAAATGTTTACAATCAAC
AGACACAaaatcataTGGACCACTCAAGgatgaAGACAgaatatttacaa
atttataTGGAAGACATGATTGGAAACTTAAAGGTGCAATGGCAAGGGGA
GACTggtacaaaacaaaagaaattatagtCAAGGGTCATGATTGGATTCT
TGATGAAATCAAAACGTCAGGATTACGTGGACGTGGTGGAGCAGGTTTCC
CTACTGGATTAAAATGGAGTTTCATGAACAAACCAGATGACGGTCGTCCA
AAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGGCACTTGCAAAGA
TCGTGAAATTATGAGACATGACCCACACAAATTGGTAGAAGGATGCCTGG
TAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATATACATCCGAGGT
GAATTTTATAACGAAGCGTCTAACATGCAGGTTGCCATCAACGAAGCATA
CAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTGGATACGATTTCG
ATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGTGGCGAAGAAACT
GCACTTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCCACGATTGAAGCC
TCCATTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCACCACCGTCGCTA
ACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGTCGTGGAGGAAGT
TGGTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACAAAAGCTTTTCAA
CATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAGAAGAAATGTCTA
TCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGTGTCACCGGTGGA
TGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATCTACACCACTCAT
CCCTATAGATGTCTGCAGTGACGTCATGATGGATTTCGACGACTTAGTTC
GAGCACAAACAGGCCTTGGAACGGCTGCCATCATCGTTATGAACAAGCAG
AGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTTTTACAAACACGA
AAGTTGTGGACAGtgTACACCATGTCGCGAGGGAGTTGGATGGATGAACA
AAATCATGGCTCGATTCGtcgAAGGAAAAGCTAAACAGGGAGAAATTGAT
ATGTTATGGGAAGTGAGCAAACAGATCGAAGGACATACAATTTGTGCCCT
CGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTGATCCGTCATTTCCGAC
CAGTACTGGAAGCCCGTATGAACCAATATCAAGACGATTTCGATACAAAA
GTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCATTGGCTATCTCGAAATG
TTTACAATCAACAGACACAaaatcataTGGACCACTCAAGgatgaAGACA
gaatatttacaaatttataTGGAAGACATGATTGGAAACTTAAAGGTGCA
ATGGCAAGGGGAGACTggtacaaaacaaaagaaattatagtCAAGGGTCA
TGATTGGATTCTTGATGAAATCAAAACGTCAGGATTACGTGGACGTGGTG
GAGCAGGTTTCCCTACTGGATTAAAATGGAGTTTCATGAACAAACCAGAT
GACGGTCGTCCAAAATATCTCGTTGTCAACGCTGACGAAGGTGAGCCAGG
CACTTGCAAAGATCGTGAAATTATGAGACATGACCCACACAAATTGGTAG
AAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGCGCCGCTTATATA
TACATCCGAGGTGAATTTTATAACGAAGCGTCTAACATGCAGGTTGCCAT
CAACGAAGCATACAAAGCTGGTTTCCTTGGTAAGGATGCATGTGGAAGTG
GATACGATTTCGATGTTTACATGCACCGTGGTGCAGGAGCGTACATTTGT
GGCGAAGAAACTGCACTTATTGAAAGTTTAGAAGGTAAACAAGGAAAGCC
ACGATTGAAGCCTCCATTTCCAGCTGACGTCGGTGTTTTCGGATGTCCCA
CCACCGTCGCTAACGTTGAAACTGTCGCCGTCGCTCCCGAAATTTGCCGT
CGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCTCACGAAACTCAGGACA
AAAGCTTTTCAACATCTCTGGCCACGTGAACAACCCGTGTACCGTCGAAG
AAGAAATGTCTATCCCATTGAAAGAGCTCATCGAACGACACGCTGGTGGT
GTCACCGGTGGATGGGACAACTTGCTGGCCATCATCCCCGGTGGATCATC
TACACCACTCATCCCTATAGATGTCTGCAGTGACGTCATGATGGATTTCG
ACGACTTAGTTCGAGCACAAACAGGCCTTGGAACGGCTGCCATCATCGTT
ATGAACAAGCAGAGCGACATCGTCCGTTGCATTGCACGTCTCATAGAGTT
TTACAAACACGAAAGTTGTGGACAGtgTACACCATGTCGCGAGGGAGTTG
GATGGATGAACAAAATCATGGCTCGATTCGtcgAAGGAAAAGCTAAACAG
GGAGAAATTGATATGTTATGGGAAGTGAGCAAACAGATCGAAGGACATAC
AATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTACAAGGCTTGATCC
GTCATTTCCGACCAGTACTGGAAGCCCGTATGAACCAATATCAAGACGAT
TTCGATACAAAAGTGGCTGCTGCTGTCTAAAGCGGAAGACTTTCATTGGC
TATCTCGAAATGTTTACAATCAACAGACACAaaatcataTGGACCACTCA
AGgatgaAGACAgaatatttacaaatttataTGGAAGACATGATTGGAAA
CTTAAAGGTGCAATGGCAAGGGGAGACTggtacaaaacaaaagaaattat
agtCAAGGGTCATGATTGGATTCTTGATGAAATCAAAACGTCAGGATTAC
GTGGACGTGGTGGAGCAGGTTTCCCTACTGGATTAAAATGGAGTTTCATG
AACAAACCAGATGACGGTCGTCCAAAATATCTCGTTGTCAACGCTGACGA
AGGTGAGCCAGGCACTTGCAAAGATCGTGAAATTATGAGACATGACCCAC
ACAAATTGGTAGAAGGATGCCTGGTAGCTGGCCGTGCCATGGGCGCCCGC
GCCGCTTATATATACATCCGAGGTGAATTTTATAACGAAGCGTCTAACAT
GCAGGTTGCCATCAACGAAGCATACAAAGCTGGTTTCCTTGGTAAGGATG
CATGTGGAAGTGGATACGATTTCGATGTTTACATGCACCGTGGTGCAGGA
GCGTACATTTGTGGCGAAGAAACTGCACTTATTGAAAGTTTAGAAGGTAA
ACAAGGAAAGCCACGATTGAAGCCTCCATTTCCAGCTGACGTCGGTGTTT
TCGGATGTCCCACCACCGTCGCTAACGTTGAAACTGTCGCCGTCGCTCCC
GAAATTTGCCGTCGTGGAGGAAGTTGGTTCGTTGGTATGGGCCGCTCACG
AAACTCAGGACAAAAGCTTTTCAACATCTCTGGCCACGTGAACAACCCGT
GTACCGTCGAAGAAGAAATGTCTATCCCATTGAAAGAGCTCATCGAACGA
CACGCTGGTGGTGTCACCGGTGGATGGGACAACTTGCTGGCCATCATCCC
CGGTGGATCATCTACACCACTCATCCCTATAGATGTCTGCAGTGACGTCA
TGATGGATTTCGACGACTTAGTTCGAGCACAAACAGGCCTTGGAACGGCT
GCCATCATCGTTATGAACAAGCAGAGCGACATCGTCCGTTGCATTGCACG
TCTCATAGAGTTTTACAAACACGAAAGTTGTGGACAGtgTACACCATGTC
GCGAGGGAGTTGGATGGATGAACAAAATCATGGCTCGATTCGtcgAAGGA
AAAGCTAAACAGGGAGAAATTGATATGTTATGGGAAGTGAGCAAACAGAT
CGAAGGACATACAATTTGTGCCCTCGGTGACGGTGCTGCTTGGCCAGTAC
AAGGCTTGATCCGTCATTTCCGACCAGTACTGGAAGCCCGTATGAACCAA
TATCAAGACGATTTCGATACAAAAGTGGCTGCTGCTGTCTAA
Gene-mRNA-Prot