Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00073747-protein ID=TCONS_00073747-protein|Name=TCONS_00073747-protein|organism=Clytia hemisphaerica|type=polypeptide|length=379bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00073747-protein vs. Swiss-Prot (Human)
Match: MAFG (Transcription factor MafG OS=Homo sapiens GN=MAFG PE=1 SV=1) HSP 1 Score: 99.3673 bits (246), Expect = 5.763e-25 Identity = 50/95 (52.63%), Postives = 67/95 (70.53%), Query Frame = 0 Query: 200 LTEEELAEMPVKDLNALLRGLPDAEVIKLKQRRRTIKNRGYAQTSRTKRTTQKSTLEDEKSILESELQKLADENDLLRKERDEAKIKLEAFERFA 294 LT+EEL M V++LN LRGL E+++LKQRRRT+KNRGYA + R KR TQK LE +K+ L+ E++KLA EN ++ E D + K EA + FA Sbjct: 24 LTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFA 118 The following BLAST results are available for this feature:
BLAST of TCONS_00073747-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|