Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00073009-protein ID=TCONS_00073009-protein|Name=TCONS_00073009-protein|organism=Clytia hemisphaerica|type=polypeptide|length=278bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0005509 calcium ion binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0005509 calcium ion binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 240 260 Expect = 1.2E-4 / Score = 31.4 Expect = 3.5 / Score = 13.4 Expect = 0.024 / Score = 23.8 Expect = 0.33 / Score = 20.0 Expect = 1.1E-4 / Score = 31.6 Expect = 87.0 / Score = 2.1 Expect = 2.5E-9 / Score = 37.4 Expect = 6.5E-9 / Score = 36.0 Expect = 6.0E-8 / Score = 33.0 Score = 13.063 Score = 9.52 Score = 13.398 Score = 11.612 Score = 10.943 Score = 8.627 Expect = 2.95844E-7 / Score = 45.2313 Expect = 7.45215E-8 / Score = 47.1573 Expect = 1.91541E-10 / Score = 54.0909 Expect = 0.2 / Score = 11.1 Expect = 1.6E-5 / Score = 24.1 Expect = 1.3E-7 / Score = 30.8 Expect = 1.9E-11 / Score = 43.1 Expect = 2.4E-12 / Score = 46.5 Expect = 5.8E-13 / Score = 48.4 Expect = 3.7E-11 / Score = 42.6 Score = Score = Score = Score = Score = Score = Score = Score = Sequence SM00054 PF13499 PS50222 PS50222 PS50222 PS50222 PS50222 PS50222 cd00051 cd00051 cd00051 G3DSA:1.10.238.10 G3DSA:1.10.238.10 G3DSA:1.10.238.10 PS00018 PS00018 PS00018 PS00018 PS00018 PS00018 SSF47473 SSF47473
Blast
BLAST of TCONS_00073009-protein vs. Swiss-Prot (Human)
Match:
CALB2 (Calretinin OS=Homo sapiens GN=CALB2 PE=2 SV=2)
HSP 1 Score: 182.57 bits (462), Expect = 1.357e-56
Identity = 105/281 (37.37%), Postives = 176/281 (62.63%), Query Frame = 0
Query: 3 AEKEKTAPFVKKFNGIEKLSSEEFLLIFRKYDKDGNGYIERGELDRFLSDILRQK-----LANAQDLDELRKTILDKYDTNADGKISLSELALILPTQENYLSAIVNNNRLHV---VDFMKIWYHYDRDKSGYLEKSELKGFIRDFLLRSLKFDDKITPQVIDERTEKVLETFDKNKDGKIEISELAKFLNVQDNFLMKFKNENDALSAEQFDAIFNHYDTDGNGYIEDVELLAFLRDLLQNKRRDPTSKDLEMYRSCILEISDKDNDGKLSKAELKILLI 275
A ++ P++ + +L++ +FL I++ +D DGNGYIE EL+ F ++ + + ++ + + E K + KYD N+DGKI ++ELA ILPT+EN+L R HV +FM+ W YD D+SGY+E +ELKGF+ D L ++ + D+ P+ + E T+ +L FD N DGK+ +SE+++ L VQ+NFL+KF+ L++E+F+AIF YD D +GYI++ EL A L+DL + +++ + L YR ++ +++ GKL + +L+I+L
Sbjct: 2 AGPQQQPPYLH----LAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCF----RQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDE--PK-LQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMK--LTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEA---GKLYRKDLEIVLC 266
The following BLAST results are available for this feature:
BLAST of TCONS_00073009-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M A A E K E K T A P F V K K F N G I E K L S S E E F L L I F R K Y D K D G N G Y I E R G E L D R F L S D I L R Q K L A N A Q D L D E L R K T I L D K Y D T N A D G K I S L S E L A L I L P T Q E N Y L S A I V N N N R L H V V D F M K I W Y H Y D R D K S G Y L E K S E L K G F I R D F L L R S L K F D D K I T P Q V I D E R T E K V L E T F D K N K D G K I E I S E L A K F L N V Q D N F L M K F K N E N D A L S A E Q F D A I F N H Y D T D G N G Y I E D V E L L A F L R D L L Q N K R R D P T S K D L E M Y R S C I L E I S D K D N D G K L S K A E L K I L L I P N K 20 40 60 80 100 120 140 160 180 200 220 240 260 Expect = 1.36e-56 / Id = 37.37 Sequence CALB2
Match Name E-value Identity Description
CALB2 1.357e-56 37.37 Calretinin OS=Homo sapiens GN=CALB2 PE=2 SV=2 [more]
back to top
