Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072699-protein ID=TCONS_00072699-protein|Name=TCONS_00072699-protein|organism=Clytia hemisphaerica|type=polypeptide|length=123bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00072699-protein vs. Swiss-Prot (Human)
Match: ANO3 (Anoctamin-3 OS=Homo sapiens GN=ANO3 PE=1 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 1.478e-17 Identity = 43/106 (40.57%), Postives = 64/106 (60.38%), Query Frame = 0 Query: 6 EKVSVEAVTGWVTKAFDNNATPYFAVIICLWGTVFCEYWKRTNALLAYKWD-VDLFEEQETNRPQFIGTTVKK---NPVSGEYEPHYPKWRKVLKSMGSMSIILFM 107 ++++ + VT FDN T +FA+ + +W TVF E+WKR ++L Y WD ++ EE+ET RPQF K NP++G+ EPH P KV + + S+S I FM Sbjct: 452 QRLNDSCIYAKVTYLFDNGGTVFFAIFMAIWATVFLEFWKRRRSILTYTWDLIEWEEEEETLRPQFEAKYYKMEIVNPITGKPEPHQPSSDKVTRLLVSVSGIFFM 557 The following BLAST results are available for this feature:
BLAST of TCONS_00072699-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|