Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00071693-protein ID=TCONS_00071693-protein|Name=TCONS_00071693-protein|organism=Clytia hemisphaerica|type=polypeptide|length=486bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
Term Definition
GO:0016021 integral component of membrane
Vocabulary: Biological Process
Term Definition
GO:0006811 ion transport
Vocabulary: Molecular Function
Term Definition
GO:0005216 ion channel activity GO:0005230 extracellular ligand-gated ion channel activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006811 ion transport
cellular_component
GO:0016021 integral component of membrane
molecular_function
GO:0005230 extracellular ligand-gated ion channel activity
molecular_function
GO:0005216 ion channel activity
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
50 100 150 200 250 300 350 400 450 Score = 29.01 Score = 44.19 Score = 47.03 Score = 24.05 Expect = 2.3E-10 / Score = 40.9 Score = Expect = 1.8E-20 / Score = 72.6 Score = Expect = 1.5E-53 / Score = 181.0 Expect = 5.1E-49 / Score = 166.6 Score = Score = Sequence PR00252 PF02932 SSF90112 G3DSA:1.20.58.390 mobidb-lite G3DSA:2.70.170.10 PF02931 SSF63712 PS00236
IPR Term IPR Description Source Source Term Source Description Alignment
IPR006201 Neurotransmitter-gated ion-channel PRINTS PR00252 NRIONCHANNEL coord: 96..112 IPR006029 Neurotransmitter-gated ion-channel transmembrane domain PFAM PF02932 Neur_chan_memb coord: 273..424 IPR006029 Neurotransmitter-gated ion-channel transmembrane domain SUPERFAMILY 90112 Neurotransmitter-gated ion-channel transmembrane pore coord: 263..477 None No IPR available GENE3D 1.20.58.390 coord: 269..484 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 395..425 IPR006202 Neurotransmitter-gated ion-channel ligand-binding domain GENE3D 2.70.170.10 coord: 32..268 IPR006202 Neurotransmitter-gated ion-channel ligand-binding domain PFAM PF02931 Neur_chan_LBD coord: 47..262 IPR006202 Neurotransmitter-gated ion-channel ligand-binding domain SUPERFAMILY 63712 Nicotinic receptor ligand binding domain-like coord: 46..261 IPR018000 Neurotransmitter-gated ion-channel, conserved site PROSITE PS00236 NEUROTR_ION_CHANNEL coord: 176..190
Blast
BLAST of TCONS_00071693-protein vs. Swiss-Prot (Human)
Match:
ACHA7 (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens GN=CHRNA7 PE=1 SV=5)
HSP 1 Score: 181.415 bits (459), Expect = 2.983e-51
Identity = 90/297 (30.30%), Postives = 157/297 (52.86%), Query Frame = 0
Query: 58 NYKPEVKASQEEGRRRLDVIFDINIRTILGLEVKTQTFHLTAVIHMRWKDKRLTWNESEFDGIDTLNVGNSIVWTPDIMLYNDVNEETLSHTEIFRSKVLIQNDGTVIWTNPVTIKSTCQVDVTWFPVDYQVCNLTFGSWSYSEQVMNIKFRNKKKDRDMIKSDFHIPSGEWSMEEIKFFEEEKTFECCKNPFSVITLQVFMKRYPDFYYLYVFLPFISQIILFLLIFHIHPDQGDRLSYGVALLLNMTMYMIFLSDKLPEKSDSVPYVGALFVTFFFLLSIALVLSAVTMHCSTRD 354
NY P + + + L V F +++ I+ ++ K Q + M W D L WN SE+ G+ T+ + +W PDI+LYN +E F + VL+ + G + P KS+C +DV WFP D Q C L FGSWSY ++++ + +IP+GEW + I E+ +ECCK P+ +T V M+R +Y L + +P + L LL+F + D G+++S G+ +LL++T++M+ +++ +P SDSVP + F + ++ +++V++ + + D
Sbjct: 36 NYNPLERPVANDSQP-LTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADER---FDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISG-------YIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHD 321
The following BLAST results are available for this feature:
BLAST of TCONS_00071693-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
T Q R S M N L K I L K S N D V Y V L T I C L I L V V G S G A N F S N G T G N I T R G K S L T D I Y D K I F G E S A N Y K P E V K A S Q E E G R R R L D V I F D I N I R T I L G L E V K T Q T F H L T A V I H M R W K D K R L T W N E S E F D G I D T L N V G N S I V W T P D I M L Y N D V N E E T L S H T E I F R S K V L I Q N D G T V I W T N P V T I K S T C Q V D V T W F P V D Y Q V C N L T F G S W S Y S E Q V M N I K F R N K K K D R D M I K S D F H I P S G E W S M E E I K F F E E E K T F E C C K N P F S V I T L Q V F M K R Y P D F Y Y L Y V F L P F I S Q I I L F L L I F H I H P D Q G D R L S Y G V A L L L N M T M Y M I F L S D K L P E K S D S V P Y V G A L F V T F F F L L S I A L V L S A V T M H C S T R D T P L P M I A H K V K A I T N R I W P C G K K S N A R S K S S K Y G S Y N M K L R K P K S E T D S N F N D P R G P K G D A N R K V S D L I E S D S E S S S V E I A R N D K Y E N R F E G W F E F M R F T E K W L T V I F A F L L V V I P I I I A G S V N T R M T Q P D Y 50 100 150 200 250 300 350 400 450 Expect = 2.98e-51 / Id = 30.30 Sequence ACHA7
Match Name E-value Identity Description
ACHA7 2.983e-51 30.30 Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
