Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00071424-protein ID=TCONS_00071424-protein|Name=TCONS_00071424-protein|organism=Clytia hemisphaerica|type=polypeptide|length=168bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00071424-protein vs. Swiss-Prot (Human)
Match: AAKB2 (5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens GN=PRKAB2 PE=1 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 6.293e-21 Identity = 34/78 (43.59%), Postives = 49/78 (62.82%), Query Frame = 0 Query: 90 PIVFHWGYGGKEVFLSGSFYEWKKRVPMINSGDEYTTTVDLPSGTHEFKYIVDGHWQHDPNQNTVNDHFAGRNNILTV 167 P V W GGKEVF+SGSF W ++P+I S +++ +DLP G H++K+ VDG W HDP++ V NN++ V Sbjct: 78 PTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHV 155 The following BLAST results are available for this feature:
BLAST of TCONS_00071424-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|