Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00071237-protein ID=TCONS_00071237-protein|Name=TCONS_00071237-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1143bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00071237-protein vs. Swiss-Prot (Human)
Match: ARI1A (AT-rich interactive domain-containing protein 1A OS=Homo sapiens GN=ARID1A PE=1 SV=3) HSP 1 Score: 138.658 bits (348), Expect = 7.195e-33 Identity = 56/102 (54.90%), Postives = 81/102 (79.41%), Query Frame = 0 Query: 985 LKREFAFPPDSVEATKPVLRKRKKLTSKDLGPVEAWRIMMSLKSGLVSECTWAIDTLNILLADNNTITYFHLKQLPGLLDTLMDHYRRSMGNLFDDFSFTEI 1086 ++R+ FPP SVEAT+PVL++R++LT KD+G EAWR+MMSLKSGL++E TWA+DT+NILL D+N+I F+L QLPGLL+ L++++RR + +F E+ Sbjct: 1635 IRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEV 1736 The following BLAST results are available for this feature:
BLAST of TCONS_00071237-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|