Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00069008-protein ID=TCONS_00069008-protein|Name=TCONS_00069008-protein|organism=Clytia hemisphaerica|type=polypeptide|length=110bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00069008-protein vs. Swiss-Prot (Human)
Match: RNK (Ribonuclease kappa OS=Homo sapiens GN=RNASEK PE=2 SV=2) HSP 1 Score: 71.633 bits (174), Expect = 2.567e-17 Identity = 36/72 (50.00%), Postives = 45/72 (62.50%), Query Frame = 0 Query: 27 CCGPKLSNCCFVLSIWGMIMLAIMGILFRVQSVALIEDIPKGGTEEEG--------FQTASTNCFIAAGLYV 90 CCGPKL+ C VLS WG+IML ++GI F V S LIED+P + E ++ S NCFIAAGLY+ Sbjct: 45 CCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYL 116 The following BLAST results are available for this feature:
BLAST of TCONS_00069008-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|