Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00068500-protein ID=TCONS_00068500-protein|Name=TCONS_00068500-protein|organism=Clytia hemisphaerica|type=polypeptide|length=235bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00068500-protein vs. Swiss-Prot (Human)
Match: MON2 (Protein MON2 homolog OS=Homo sapiens GN=MON2 PE=1 SV=3) HSP 1 Score: 80.8777 bits (198), Expect = 1.785e-17 Identity = 40/96 (41.67%), Postives = 66/96 (68.75%), Query Frame = 0 Query: 3 LATTLEDFLFSKSPPPDTQTLEQHQADEQIDVNILKLIRQEILPNSTSLPQEFVDTLMKLLNRGSSHTTSTTMFDNVWEILRQKKFAK--FEEIVH 96 LA T EDFLF+KS PPD ++++ Q +E IDV +++LI EILP + +P+EFV +M +LN+GS H+ S++ + +I +++F+K FE ++ Sbjct: 1493 LANTFEDFLFTKSIPPDNLSIQEFQRNENIDVEVVQLISNEILPYANFIPKEFVGQIMTMLNKGSIHSQSSSFTEAEIDIRLREEFSKMCFETLLQ 1588 The following BLAST results are available for this feature:
BLAST of TCONS_00068500-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|