Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066948-protein ID=TCONS_00066948-protein|Name=TCONS_00066948-protein|organism=Clytia hemisphaerica|type=polypeptide|length=796bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR000504 RRM_dom
Vocabulary: Molecular Function
Term Definition
GO:0003676 nucleic acid binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0003676 nucleic acid binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
100 200 300 400 500 600 700 Expect = 6.3E-7 / Score = 39.0 Expect = 1.1E-4 / Score = 21.8 Score = 10.19 Score = Expect = 2.9E-30 / Score = 104.6 Expect = 1.1E-12 / Score = 47.5 Expect = 1.6E-4 / Score = 21.3 Score = Score = Score = Expect = 7.32578E-25 / Score = 99.9391 Expect = 1.27768E-9 / Score = 54.6185 Score = Score = Sequence SM00360 PF00076 PS50102 SSF54928 G3DSA:1.10.1410.10 G3DSA:3.30.70.330 G3DSA:3.30.460.10 mobidb-lite mobidb-lite mobidb-lite cd05402 cd00590 SSF81301 SSF81631
IPR Term IPR Description Source Source Term Source Description Alignment
IPR000504 RNA recognition motif domain SMART SM00360 rrm1_1 coord: 58..130 IPR000504 RNA recognition motif domain PFAM PF00076 RRM_1 coord: 59..127 IPR000504 RNA recognition motif domain PROSITE PS50102 RRM coord: 57..134 IPR000504 RNA recognition motif domain SUPERFAMILY 54928 RNA-binding domain, RBD coord: 51..137 None No IPR available GENE3D 1.10.1410.10 coord: 294..490 None No IPR available GENE3D 3.30.70.330 coord: 47..160 None No IPR available GENE3D 3.30.460.10 coord: 200..293 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 570..622 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 133..162 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 504..529 None No IPR available CDD cd05402 NT_PAP_TUTase coord: 197..315 None No IPR available CDD cd00590 RRM_SF coord: 59..130 None No IPR available SUPERFAMILY 81301 Nucleotidyltransferase coord: 180..315 None No IPR available SUPERFAMILY 81631 PAP/OAS1 substrate-binding domain coord: 322..487
Blast
BLAST of TCONS_00066948-protein vs. Swiss-Prot (Human)
Match:
TUT7 (Terminal uridylyltransferase 7 OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1)
HSP 1 Score: 129.413 bits (324), Expect = 1.809e-30
Identity = 92/321 (28.66%), Postives = 165/321 (51.40%), Query Frame = 0
Query: 172 PKAISLMDQMS-RFKEGFGLSQGDMEVRMLICQLLQSVLEEAYPNCQVKLFGSSANGLGCKGCDLDI--TVLSGESDDNLEQPTSILKEMREILERFAPGFKNIFLVESQKNCSIIKMYHTDSELNVDLSLNNRLAISNTELLKAYICQDDTIQSFFFTVRAWAKMNNLIGRNAGQMTNYALMLMMIHFLQQHDPPYLLCLQDCH-GNKLTNDMIGPWDCWFAKE-------RTAVKSRIEDPGLLLLRFFKFAHEQLS-SPKIIAIHTLKPLQKYQLHPELTRTVFITQDPFKLSHNVTQNITEDGLQNLQQVFTKILGR 480
PK ++++DQ+ + + F + + + R I Q L+S + + +P ++ LFGSS NG G K DLD+ T+ E+ + L+ +I +E+ +L + + G +NI + + K I+K +H S L VD+SL N LA+ NT LL AY D ++ +T++ + KM ++ + G +++YA LM+++FLQQ +PP + LQ+ + G K + W+ +F + + E G L L +F E+ +I+I L ++ + T + +DPF L+HN+ ++ + + F I GR
Sbjct: 995 PKFLNILDQVCIQCYKDFSPTIIEDQAREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTI-EELARVLRKHS-GLRNILPITTAK-VPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAIDPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEKKPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRRKSLLTTFK--KQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAF--INGR 1308
The following BLAST results are available for this feature:
