Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066803-protein ID=TCONS_00066803-protein|Name=TCONS_00066803-protein|organism=Clytia hemisphaerica|type=polypeptide|length=272bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term Definition
IPR006029 Neurotrans-gated_channel_TM
Vocabulary: Biological Process
Term Definition
GO:0006811 ion transport
Vocabulary: Cellular Component
Term Definition
GO:0016021 integral component of membrane
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006811 ion transport
cellular_component
GO:0016021 integral component of membrane
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 240 260 Expect = 9.9E-16 / Score = 58.4 Score = Expect = 4.8E-20 / Score = 71.2 Sequence PF02932 SSF90112 G3DSA:1.20.58.390
IPR Term IPR Description Source Source Term Source Description Alignment
IPR006029 Neurotransmitter-gated ion-channel transmembrane domain PFAM PF02932 Neur_chan_memb coord: 31..260 IPR006029 Neurotransmitter-gated ion-channel transmembrane domain SUPERFAMILY 90112 Neurotransmitter-gated ion-channel transmembrane pore coord: 24..264 None No IPR available GENE3D 1.20.58.390 coord: 24..270
Blast
BLAST of TCONS_00066803-protein vs. Swiss-Prot (Human)
Match:
ACHA3 (Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens GN=CHRNA3 PE=1 SV=4)
HSP 1 Score: 82.0333 bits (201), Expect = 1.150e-17
Identity = 67/261 (25.67%), Postives = 129/261 (49.43%), Query Frame = 0
Query: 11 FSEIIYVVRIKRKPLFLITSLIMPKFGITLISLLAHVIPAASGERILMLIDLMLVLALFLTNVMDIIPGAAGEVPFFTYFLLLTLIGMVTNIVTMVYTLSIYFANCTVLEMPRWLRYYVLDHLAPSMGYRDRYTT---------PKWMIKL-------MAIEEHCQRNQQQNPINSILGKRHPGRL----WGATELRSNVIEIVDDLSQGHSLSSLNLCLLS--QKLSLILDWLKEEERKRILKDDWLLVAKALDQVTLYI 249
+ +I Y + I+R PLF +LI+P I+ +++L +P+ GE++ + I ++L L +FL + + IP + +P +LL T+I + +IV V+ L++++ T MP W++ L+ L P + + R T+ P + +L A + C+ + + G H R+ + A RS+ E VD + SLS+L+ + Q + I + +K + + ++DDW VA +D++ L++
Sbjct: 228 YPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLN-LLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQ--DGMCGYCHHRRIKISNFSANLTRSSSSESVDAV---LSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWV 482
The following BLAST results are available for this feature:
BLAST of TCONS_00066803-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
M N F K N P D M N K F S E I I Y V V R I K R K P L F L I T S L I M P K F G I T L I S L L A H V I P A A S G E R I L M L I D L M L V L A L F L T N V M D I I P G A A G E V P F F T Y F L L L T L I G M V T N I V T M V Y T L S I Y F A N C T V L E M P R W L R Y Y V L D H L A P S M G Y R D R Y T T P K W M I K L M A I E E H C Q R N Q Q Q N P I N S I L G K R H P G R L W G A T E L R S N V I E I V D D L S Q G H S L S S L N L C L L S Q K L S L I L D W L K E E E R K R I L K D D W L L V A K A L D Q V T L Y I N C S I L A T V I F W F F Y K A Y S C S L V N 20 40 60 80 100 120 140 160 180 200 220 240 260 Expect = 1.15e-17 / Id = 25.67 Sequence ACHA3
Match Name E-value Identity Description
ACHA3 1.150e-17 25.67 Neuronal acetylcholine receptor subunit alpha-3 OS... [more]
back to top
