Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066702-protein ID=TCONS_00066702-protein|Name=TCONS_00066702-protein|organism=Clytia hemisphaerica|type=polypeptide|length=791bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0005515 protein binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0005515 protein binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
100 200 300 400 500 600 700 Expect = 1.3E-7 / Score = 41.3 Expect = 3.9E-12 / Score = 45.8 Score = 15.856 Score = Expect = 17.0 / Score = 12.8 Expect = 0.015 / Score = 24.5 Expect = 100.0 / Score = 6.7 Expect = 0.14 / Score = 21.3 Expect = 0.023 / Score = 23.9 Expect = 5.8E-6 / Score = 35.8 Expect = 1.1 / Score = 18.2 Expect = 0.051 / Score = 22.7 Expect = 1.5E-5 / Score = 34.4 Expect = 2.0 / Score = 17.4 Expect = 4.0E-45 / Score = 153.3 Expect = 1.2E-21 / Score = 76.3 Expect = 0.84 / Score = 9.8 Expect = 0.013 / Score = 15.4 Score = Score = Score = Score = Sequence SM00256 PF12937 PS50181 SSF81383 SM00367 G3DSA:3.80.10.10 PF13516 mobidb-lite mobidb-lite mobidb-lite SSF52047
IPR Term IPR Description Source Source Term Source Description Alignment
IPR001810 F-box domain SMART SM00256 fbox_2 coord: 423..463 IPR001810 F-box domain PFAM PF12937 F-box-like coord: 421..464 IPR001810 F-box domain PROSITE PS50181 FBOX coord: 417..463 IPR001810 F-box domain SUPERFAMILY 81383 F-box domain coord: 421..460 IPR006553 Leucine-rich repeat, cysteine-containing subtype SMART SM00367 LRR_CC_2 coord: 650..674 IPR032675 Leucine-rich repeat domain, L domain-like GENE3D 3.80.10.10 coord: 654..784 IPR001611 Leucine-rich repeat PFAM PF13516 LRR_6 coord: 727..750 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 377..401 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 1..45 None No IPR available MOBIDB_LITE mobidb-lite disorder_prediction coord: 168..323 None No IPR available SUPERFAMILY 52047 RNI-like coord: 451..770
Blast
BLAST of TCONS_00066702-protein vs. Swiss-Prot (Human)
Match:
FBXL7 (F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1)
HSP 1 Score: 232.646 bits (592), Expect = 6.479e-68
Identity = 133/372 (35.75%), Postives = 220/372 (59.14%), Query Frame = 0
Query: 423 LPDKLLIRIFTYLDTSDVCRLSRVCRRWSELYLSEKLWEHIKVTNMTSLDIDSTLNVMLQRLAYTTS--CLNIRQMKLDGCKELTDEGIQTMALRCPELRALEIASCDQVTARGVYNVLVNCPNLAFLNLSGCEGVS--SFSNCSDIISSPFSFGE--LKYLDLSSCSCFTDSDIEILLGRAPSLEYLYLRLCDSISNIGIEAIARLCPNLKEISLNDCVNITDHGVLKLLDSCHNLRYVSLAKCP-ITNMVLEQIASSPNNLLRHLNLYDCEYITDIAIMKLSASCPRLRSLDIGKCRKLTDASLYGLS-RCTLLRRLNLKGCCKVTDAGLRKLATICKNLRHLDVRDCLFSPETYEYVRLRCPLCDIQRS 786
LPD +++IF++L T+ +CR +RVCRRW L +LW I++T T +++D L V+ +RL T CL + + + GC+ LTD G+ T+A CPELR LE++ C ++ V++V+ CPNL L++SGC V+ S + + I SP + ++YLD++ C D + + L +LYLR C +++ G+ + C ++KE+S++DC ++D G+ ++ LRY+S+A C +T++ + +A + LR+LN CE ITD + L+ +C +L+SLDIGKC ++D L L+ C L+RL+LK C +T GL+ +A C +L+ L+V+DC S E +V+ C C I+ +
Sbjct: 117 LPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGET-INVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSK-LRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHT 486
The following BLAST results are available for this feature:
