Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066671-protein ID=TCONS_00066671-protein|Name=TCONS_00066671-protein|organism=Clytia hemisphaerica|type=polypeptide|length=1588bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
Term Definition
GO:0006508 proteolysis
Vocabulary: Molecular Function
Term Definition
GO:0008234 cysteine-type peptidase activity
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006508 proteolysis
molecular_function
GO:0008234 cysteine-type peptidase activity
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
200 400 600 800 1000 1200 1400 Score = Score = Expect = 1.7E-87 / Score = 293.4 Expect = 1.49524E-91 / Score = 295.687 Score = Score = 58.0 Score = 43.56 Score = 79.08 Expect = 4.3E-79 / Score = 278.8 Expect = 2.3E-63 / Score = 214.1 Expect = 2.1E-6 / Score = 37.2 Expect = 2.1E-6 / Score = 28.0 Score = Score = Sequence Coil Coil G3DSA:3.90.70.10 cd02248 SSF54001 PR00705 SM00645 PF00112 SM00848 PF08246 PS00139 PS00640
IPR Term IPR Description Source Source Term Source Description Alignment
None No IPR available COILS Coil Coil coord: 1501..1521 None No IPR available COILS Coil Coil coord: 1157..1186 None No IPR available GENE3D 3.90.70.10 coord: 767..1090 None No IPR available CDD cd02248 Peptidase_C1A coord: 868..1080 None No IPR available SUPERFAMILY 54001 Cysteine proteinases coord: 770..1081 IPR000668 Peptidase C1A, papain C-terminal PRINTS PR00705 PAPAIN coord: 1030..1040 IPR000668 Peptidase C1A, papain C-terminal SMART SM00645 pept_c1 coord: 867..1081 IPR000668 Peptidase C1A, papain C-terminal PFAM PF00112 Peptidase_C1 coord: 867..1080 IPR013201 Cathepsin propeptide inhibitor domain (I29) SMART SM00848 Inhibitor_I29_2 coord: 774..830 IPR013201 Cathepsin propeptide inhibitor domain (I29) PFAM PF08246 Inhibitor_I29 coord: 774..829 IPR000169 Cysteine peptidase, cysteine active site PROSITE PS00139 THIOL_PROTEASE_CYS coord: 885..896 IPR025661 Cysteine peptidase, asparagine active site PROSITE PS00640 THIOL_PROTEASE_ASN coord: 1045..1064
Blast
BLAST of TCONS_00066671-protein vs. Swiss-Prot (Human)
Match:
CATL2 (Cathepsin L2 OS=Homo sapiens GN=CTSV PE=1 SV=2)
HSP 1 Score: 181.415 bits (459), Expect = 2.997e-50
Identity = 115/318 (36.16%), Postives = 165/318 (51.89%), Query Frame = 0
Query: 773 RYSEFKEKHYKNKGHPHDADKRKHVFKHNARYIHSHN----RRNLSFKLKPNMFADKFDKELEHFHGALEKDTRNHEGVKEFHKIDNVKTSSHPPDQNIPEELDWRDYGAVSSVSGQGICGSCYAFSAAEAVEGAWYRKTSKMVRLSKQQLVDCSWGFGNHGCKGGHYAAALSWVYVH-GISTAKSYGKYLGQEGYCHFNDTWFGANIEGFTYVPIWNATALKRAITNHGPVAVSINTLPLSFKFYGKGIYNDPKCSKNMTTHSALVIGYGKE----NGQEYWIVKNSWSALWGENGYIRVAM-KDDLCGI---TEYP 1077
++ ++K H + G ++ R+ V++ N + I HN + F + N F D ++E G RN K K P ++P+ +DWR G V+ V Q CGSC+AFSA A+EG +RKT K+V LS+Q LVDCS GN GC GG A A +V + G+ + +SY Y+ + C + AN GFT V AL +A+ GP++V+++ SF+FY GIY +P CS H LV+GYG E N +YW+VKNSW WG NGY+++A K++ CGI YP
Sbjct: 28 KWYQWKATHRRLYG-ANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCF----RNQ-------KFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESY-PYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYP 332
The following BLAST results are available for this feature:
