Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066512-protein ID=TCONS_00066512-protein|Name=TCONS_00066512-protein|organism=Clytia hemisphaerica|type=polypeptide|length=268bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
Term Definition
GO:0033897 ribonuclease T2 activity GO:0003723 RNA binding
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
molecular_function
GO:0033897 ribonuclease T2 activity
molecular_function
GO:0003723 RNA binding
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 240 260 Expect = 2.0E-48 / Score = 164.8 Expect = 4.5E-44 / Score = 150.7 Score = Score = Score = Expect = 1.8643E-49 / Score = 162.502 Sequence G3DSA:3.90.730.10 PF00445 SSF55895 PS00531 PS00530 cd01061
Blast
BLAST of TCONS_00066512-protein vs. Swiss-Prot (Human)
Match:
RNT2 (Ribonuclease T2 OS=Homo sapiens GN=RNASET2 PE=1 SV=2)
HSP 1 Score: 90.8929 bits (224), Expect = 1.141e-21
Identity = 59/194 (30.41%), Postives = 95/194 (48.97%), Query Frame = 0
Query: 50 NNSCWDYFMLVQRWPYSTCQIVNASGSPCLIPERIHSWTLHGLWPDNINTYPTHCGNE-TFDNKKIEGLEEELLMKWPN-LYEEETVDSLWKHEFEKHGTCAQSLESFKEQRSYFTNTLAYFDKWNVADVLAQQGILPRIIPYKASTLVNAIQKGYD---KIVCPGCGHIEGFGQILSQVYMCIDQAD-TLVNC 237
+N W ++VQ WP + C+ + C P WT+HGLWPD C F+ ++I+ L E+ WP+ ++ WKHE+EKHGTCA +++ Q+ YF +L + + ++ VL + GI P I Y+ + +A+ + Y KI C E Q + Q+ +C+ + D L NC
Sbjct: 30 DNHEWKKLIMVQHWPETVCEKIQND---CRDPPDY--WTIHGLWPDKSEG----CNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEV-QTIGQIELCLTKQDQQLQNC 213
The following BLAST results are available for this feature:
BLAST of TCONS_00066512-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
C L I T S S T R G S N T V L K M N K V Y L T W F V L L L G L C L T Q V E A R S I K K I E T V G P S N N S C W D Y F M L V Q R W P Y S T C Q I V N A S G S P C L I P E R I H S W T L H G L W P D N I N T Y P T H C G N E T F D N K K I E G L E E E L L M K W P N L Y E E E T V D S L W K H E F E K H G T C A Q S L E S F K E Q R S Y F T N T L A Y F D K W N V A D V L A Q Q G I L P R I I P Y K A S T L V N A I Q K G Y D K I V C P G C G H I E G F G Q I L S Q V Y M C I D Q A D T L V N C P T C E K E C H M D Q P V Y Y Q P N H P K T F V D P S V N S V 20 40 60 80 100 120 140 160 180 200 220 240 260 Expect = 1.14e-21 / Id = 30.41 Sequence RNT2
Match Name E-value Identity Description
RNT2 1.141e-21 30.41 Ribonuclease T2 OS=Homo sapiens GN=RNASET2 PE=1 SV... [more]
back to top
