Sequence
The following sequences are available for this feature:
polypeptide sequence
>TCONS_00066448-protein ID=TCONS_00066448-protein|Name=TCONS_00066448-protein|organism=Clytia hemisphaerica|type=polypeptide|length=231bp Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following
gene feature:
This polypeptide derives from the following
transcript feature(s):
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
Term Definition
GO:0005829 cytosol
Vocabulary: Molecular Function
Term Definition
GO:0016920 pyroglutamyl-peptidase activity
Vocabulary: Biological Process
Term Definition
GO:0006508 proteolysis
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category
Term Accession
Term Name
biological_process
GO:0006508 proteolysis
cellular_component
GO:0005829 cytosol
molecular_function
GO:0016920 pyroglutamyl-peptidase activity
InterPro
Analysis Name:
InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
20 40 60 80 100 120 140 160 180 200 220 Score = 39.81 Score = 32.48 Score = 34.64 Expect = 3.1E-16 / Score = 59.9 Expect = 2.8E-41 / Score = 140.8 Score = Sequence PR00706 PF01470 G3DSA:3.40.630.20 SSF53182
IPR Term IPR Description Source Source Term Source Description Alignment
IPR000816 Peptidase C15, pyroglutamyl peptidase I PRINTS PR00706 PYROGLUPTASE coord: 49..72 IPR016125 Peptidase C15, pyroglutamyl peptidase I-like PFAM PF01470 Peptidase_C15 coord: 49..217 IPR016125 Peptidase C15, pyroglutamyl peptidase I-like GENE3D 3.40.630.20 coord: 48..231 IPR016125 Peptidase C15, pyroglutamyl peptidase I-like SUPERFAMILY 53182 Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) coord: 48..229
Blast
BLAST of TCONS_00066448-protein vs. Swiss-Prot (Human)
Match:
PGPI (Pyroglutamyl-peptidase 1 OS=Homo sapiens GN=PGPEP1 PE=1 SV=1)
HSP 1 Score: 114.775 bits (286), Expect = 1.521e-31
Identity = 67/185 (36.22%), Postives = 103/185 (55.68%), Query Frame = 0
Query: 48 SIFLTGFGAFGEYNTNPSWLAVQEVSKI-WPNKGEIHIKEIPVEYKYVEENIPKYLENIKPKISINVGVSGLAEDKLQLEYCAHSSDYVQPD-IDGCIGPDCSKDVCLTTKFDLEKLIACCA-----GSALQVERSDNAGRYLCEFIYYTSMKTDECPSLFVHVPVITEEITLEKITKTLESIIK 225
++ +TGFG FGE+ N SW+AVQE+ K+ + ++H+ EIPVEY+ V+ IP E P++ ++VGVSG+A + LE C H+ Y D C G C + + + + A C G + V S +AGRYLC+F YYTS+ S FVHVP + + +++ + L +II+
Sbjct: 7 AVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMAT-TVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIE 190
The following BLAST results are available for this feature:
BLAST of TCONS_00066448-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (
Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens) )
Total hits: 1
D L L P T E F L P T F L G Q T F R L E L F A R P D G T V K I S I E Q N M E K E A A T T N L S P S I F L T G F G A F G E Y N T N P S W L A V Q E V S K I W P N K G E I H I K E I P V E Y K Y V E E N I P K Y L E N I K P K I S I N V G V S G L A E D K L Q L E Y C A H S S D Y V Q P D I D G C I G P D C S K D V C L T T K F D L E K L I A C C A G S A L Q V E R S D N A G R Y L C E F I Y Y T S M K T D E C P S L F V H V P V I T E E I T L E K I T K T L E S I I K A C I Q Q V 20 40 60 80 100 120 140 160 180 200 220 Expect = 1.52e-31 / Id = 36.22 Sequence PGPI
Match Name E-value Identity Description
PGPI 1.521e-31 36.22 Pyroglutamyl-peptidase 1 OS=Homo sapiens GN=PGPEP1... [more]
back to top
