Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00065007-protein ID=TCONS_00065007-protein|Name=TCONS_00065007-protein|organism=Clytia hemisphaerica|type=polypeptide|length=212bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00065007-protein vs. Swiss-Prot (Human)
Match: RU1C (U1 small nuclear ribonucleoprotein C OS=Homo sapiens GN=SNRPC PE=1 SV=1) HSP 1 Score: 107.457 bits (267), Expect = 1.179e-29 Identity = 43/53 (81.13%), Postives = 50/53 (94.34%), Query Frame = 0 Query: 1 MPKYFCDYCDTYLTHDSPSVRKTHNNGRKHKDNVKFYYAKWMEDQAQALIDQT 53 MPK++CDYCDTYLTHDSPSVRKTH +GRKHK+NVK YY KWME+QAQ+LID+T Sbjct: 1 MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKT 53 The following BLAST results are available for this feature:
BLAST of TCONS_00065007-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|