Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00064745-protein ID=TCONS_00064745-protein|Name=TCONS_00064745-protein|organism=Clytia hemisphaerica|type=polypeptide|length=361bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00064745-protein vs. Swiss-Prot (Human)
Match: SOX18 (Transcription factor SOX-18 OS=Homo sapiens GN=SOX18 PE=1 SV=2) HSP 1 Score: 118.242 bits (295), Expect = 5.329e-30 Identity = 47/89 (52.81%), Postives = 68/89 (76.40%), Query Frame = 0 Query: 70 QETDEDEVKRPMNSFLLWAKIMRKQYASKNPNMHNAEISKLLGKIWNSMTTKDKRPYVEQAERLRVVHMRTYPNYRYAPKRRKERRNHR 158 Q DE ++RPMN+F++WAK RK+ A +NP++HNA +SK+LGK W + +KRP+VE+AERLRV H+R +PNY+Y P+R+K+ R R Sbjct: 78 QAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHPNYKYRPRRKKQARKAR 166 The following BLAST results are available for this feature:
BLAST of TCONS_00064745-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|