Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00063519-protein ID=TCONS_00063519-protein|Name=Otx|organism=Clytia hemisphaerica|type=polypeptide|length=315bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Otx vs. Swiss-Prot (Human)
Match: OTX2 (Homeobox protein OTX2 OS=Homo sapiens GN=OTX2 PE=1 SV=1) HSP 1 Score: 110.153 bits (274), Expect = 3.854e-28 Identity = 50/63 (79.37%), Postives = 55/63 (87.30%), Query Frame = 0 Query: 83 PGTPPKRRRERTTFTKAQLDVLEDLFGKTMYPDVFMREEVAKKISLAEARVQVWFKNRRAKFR 145 P TP K+RRERTTFT+AQLDVLE LF KT YPD+FMREEVA KI+L E+RVQVWFKNRRAK R Sbjct: 32 PATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCR 94 The following BLAST results are available for this feature:
BLAST of Otx vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|