Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062934-protein ID=TCONS_00062934-protein|Name=TCONS_00062934-protein|organism=Clytia hemisphaerica|type=polypeptide|length=651bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062934-protein vs. Swiss-Prot (Human)
Match: MYNN (Myoneurin OS=Homo sapiens GN=MYNN PE=1 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 1.621e-18 Identity = 35/81 (43.21%), Postives = 52/81 (64.20%), Query Frame = 0 Query: 567 RPQCPECFQTFKKRAALERHMMIHRGIKPFQCHFCNQRFRQKHHLQGHVMLHTGERPHSCALCNKRFRMRHHLLEHERISH 647 +P C C + F + ++L RHM IH+G+KP+ CH C + F Q + L+ HV HTGE+P+ C LC+K F + L+ H R+ H Sbjct: 301 KPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCDKGFAQKCQLVFHSRMHH 381 The following BLAST results are available for this feature:
BLAST of TCONS_00062934-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|