Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062480-protein ID=TCONS_00062480-protein|Name=Unc|organism=Clytia hemisphaerica|type=polypeptide|length=340bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Unc vs. Swiss-Prot (Human)
Match: UNC4 (Homeobox protein unc-4 homolog OS=Homo sapiens GN=UNCX PE=3 SV=1) HSP 1 Score: 111.309 bits (277), Expect = 3.710e-27 Identity = 46/61 (75.41%), Postives = 54/61 (88.52%), Query Frame = 0 Query: 135 RRMRMRTNFTSWQLDELENAFQKTHYPDVFMREELAMKLQLLESRVQVWFQNRRAKWRKRE 195 +R R RTNFT WQL+ELE AF ++HYPDVFMRE LA++L L+ESRVQVWFQNRRAKWRK+E Sbjct: 104 KRRRTRTNFTGWQLEELEKAFNESHYPDVFMREALALRLDLVESRVQVWFQNRRAKWRKKE 164 The following BLAST results are available for this feature:
BLAST of Unc vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|