Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00062182-protein ID=TCONS_00062182-protein|Name=TCONS_00062182-protein|organism=Clytia hemisphaerica|type=polypeptide|length=125bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00062182-protein vs. Swiss-Prot (Human)
Match: NDUB9 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9 OS=Homo sapiens GN=NDUFB9 PE=1 SV=3) HSP 1 Score: 86.2705 bits (212), Expect = 2.310e-22 Identity = 40/90 (44.44%), Postives = 62/90 (68.89%), Query Frame = 0 Query: 6 LALSKQLTHHQRVTRLYRKSLKHLLSWTMNREAWREQAVLLREKFDENKSLTDKFQIEKVVKDAEAQFELWRHPAPYIHPKAPGGSKYER 95 LA LTH Q+V RLY+++L+HL SW + R+ +R A L+R +F+E+K+ D + +++K+AE +F +HP PYI P +PGG+ YER Sbjct: 4 LASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEEFWYRQHPQPYIFPDSPGGTSYER 93 The following BLAST results are available for this feature:
BLAST of TCONS_00062182-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|