Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060494-protein ID=TCONS_00060494-protein|Name=Hox9-14C homeodomain transcription factor protein|organism=Clytia hemisphaerica|type=polypeptide|length=339bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Hox9-14C homeodomain transcription factor protein vs. Swiss-Prot (Human)
Match: HXA7 (Homeobox protein Hox-A7 OS=Homo sapiens GN=HOXA7 PE=1 SV=3) HSP 1 Score: 95.9005 bits (237), Expect = 3.138e-23 Identity = 46/83 (55.42%), Postives = 56/83 (67.47%), Query Frame = 0 Query: 184 YNTYPGMTNTGPLPAGPWICRDIDTKRKRMTYSRKQLLELEKEFHFSQFLKKERRSDLAKQLSLTERQIKIWFQNRRMKHKKE 266 + YP M ++GP D KR R TY+R Q LELEKEFHF+++L + RR ++A L LTERQIKIWFQNRRMK KKE Sbjct: 117 FRIYPWMRSSGP-----------DRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 188 The following BLAST results are available for this feature:
BLAST of Hox9-14C homeodomain transcription factor protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|