Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060435-protein ID=TCONS_00060435-protein|Name=TCONS_00060435-protein|organism=Clytia hemisphaerica|type=polypeptide|length=143bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00060435-protein vs. Swiss-Prot (Human)
Match: BAHD1 (Bromo adjacent homology domain-containing 1 protein OS=Homo sapiens GN=BAHD1 PE=1 SV=2) HSP 1 Score: 96.2857 bits (238), Expect = 4.102e-24 Identity = 53/124 (42.74%), Postives = 78/124 (62.90%), Query Frame = 0 Query: 4 PYKGEMMMSVQWYYKPTQTISKGNDIICGDEM--EVFASRHKDDNSVACIIDRCYVITLPQYNRYKAH-KQRWEEKRNRKLVVVPEVKNHRS---RLLPSPDFDPSLVYFCRFGYDYRSGKLIK 121 P GE+MMS+ WYY+P + + G + + EVFASRH+D NSVACI ++CYV+T +Y R+ A K+R E +RK +VP ++ + R +P D DP LV+ CR YD+R G+++K Sbjct: 656 PESGELMMSLLWYYRP-EHLQGGRSPSMHEPLQNEVFASRHQDQNSVACIEEKCYVLTFAEYCRFCAMAKRRGEGLPSRKTALVPPSADYSTPPHRTVPE-DTDPELVFLCRHVYDFRHGRILK 777 The following BLAST results are available for this feature:
BLAST of TCONS_00060435-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|