Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00060180-protein ID=TCONS_00060180-protein|Name=TCONS_00060180-protein|organism=Clytia hemisphaerica|type=polypeptide|length=158bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00060180-protein vs. Swiss-Prot (Human)
Match: VGLU2 (Vesicular glutamate transporter 2 OS=Homo sapiens GN=SLC17A6 PE=2 SV=1) HSP 1 Score: 84.3445 bits (207), Expect = 1.203e-19 Identity = 43/120 (35.83%), Postives = 69/120 (57.50%), Query Frame = 0 Query: 7 AACLIAVNYTGCDNTSLSVALMVMSLCFLALNQGAVTVNQMDISPRYCSILVGMTNTSASLAGCLSPWVIGYFTNGNPTREQYRKVFFCAASVATAGGLFCIIFMSGKVQPWNDMNEEKE 126 A L+ V Y+ ++++ +V+++ F VN +DI+PRY SIL+G++N +L+G + P ++G T N +RE+++ VF AA V G +F IF SG+ QPW D E E Sbjct: 397 ATLLLVVGYS--HTRGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTK-NKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPWADPEETSE 513 The following BLAST results are available for this feature:
BLAST of TCONS_00060180-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|