Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00057229-protein ID=TCONS_00057229-protein|Name=TCONS_00057229-protein|organism=Clytia hemisphaerica|type=polypeptide|length=107bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00057229-protein vs. Swiss-Prot (Human)
Match: CX6A1 (Cytochrome c oxidase subunit 6A1, mitochondrial OS=Homo sapiens GN=COX6A1 PE=1 SV=4) HSP 1 Score: 88.1965 bits (217), Expect = 3.884e-24 Identity = 42/92 (45.65%), Postives = 54/92 (58.70%), Query Frame = 0 Query: 16 GQALKDAVAAEEKHARATSMQWKKISLFIALPGIGLCAYNAIIDELEHMKHAHPEFVGFEHLRIRKTSFPWGDGNHSLFHG-HNNPLPEGYE 106 G+ + EE AR WK ++ F+ALPG+ + N + H +H PEF+ + HLRIR FPWGDGNH+LFH H NPLP GYE Sbjct: 21 GRPMSSGAHGEEGSAR----MWKTLTFFVALPGVAVSMLNVYLKS-HHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYE 107 The following BLAST results are available for this feature:
BLAST of TCONS_00057229-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|