Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00049966-protein ID=TCONS_00049966-protein|Name=TCONS_00049966-protein|organism=Clytia hemisphaerica|type=polypeptide|length=185bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00049966-protein vs. Swiss-Prot (Human)
Match: ANGP2 (Angiopoietin-2 OS=Homo sapiens GN=ANGPT2 PE=1 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 6.128e-20 Identity = 36/85 (42.35%), Postives = 51/85 (60.00%), Query Frame = 0 Query: 80 VPMKDCLAFSQAGFRKNGLYRIR-PGQARNITVFCDQTSEGGGFTTIMRRQDGSVNFQRPWKDYKFGFGKLLTEFWFGNXWLCQF 163 + +DC ++G NG+Y + P I +CD + GGG+T I RR+DGSV+FQR WK+YK GFG E+W GN ++ Q Sbjct: 279 ISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQL 363 The following BLAST results are available for this feature:
BLAST of TCONS_00049966-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|