Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00047727-protein ID=TCONS_00047727-protein|Name=TCONS_00047727-protein|organism=Clytia hemisphaerica|type=polypeptide|length=156bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00047727-protein vs. Swiss-Prot (Human)
Match: ALKB4 (Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4 OS=Homo sapiens GN=ALKBH4 PE=1 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 3.386e-21 Identity = 49/146 (33.56%), Postives = 71/146 (48.63%), Query Frame = 0 Query: 8 CNCTGIRSCLLCNKYSSSSTNHN---TQIQYYWFCPSCGKMFNGSIQIPPSDAIEHSNAFYNWCQLHEDNTPSQLQIEGIHITQAFVTSEEERALVTGIDEGEWKLSQSGRRKQDFGPKANFKKRKVKLGSFNGFPSYTEKLIGKL 150 C C GIR+CL+C + S + + +C G E S+ F W G+ + + FVT EEE LV +D WKLSQSGRRKQD+GPK NF+K+K+K F G PS++ +++ ++ Sbjct: 15 CGCKGIRTCLICERQRGSDPPWELPPAKTYRFIYCSDTGWAVG----------TEESD-FEGWA----------FPFPGVMLIEDFVTREEEAELVRLMDRDPWKLSQSGRRKQDYGPKVNFRKQKLKTEGFCGLPSFSREVVRRM 139 The following BLAST results are available for this feature:
BLAST of TCONS_00047727-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|