Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00010900-protein ID=TCONS_00010900-protein|Name=TCONS_00010900-protein|organism=Clytia hemisphaerica|type=polypeptide|length=356bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00010900-protein vs. Swiss-Prot (Human)
Match: SPEF1 (Sperm flagellar protein 1 OS=Homo sapiens GN=SPEF1 PE=1 SV=3) HSP 1 Score: 129.798 bits (325), Expect = 1.042e-35 Identity = 53/100 (53.00%), Postives = 75/100 (75.00%), Query Frame = 0 Query: 7 LDEDALQQIYTWIDEVPLSRPKKNIARDFSDGVLIAEIIHHYLPKMVDLHNYSPAHATAKKMDNWNVLGRKCFNKLNFNVKDGLIKGAVFAEPGAVELIL 106 +DE+AL Q+Y W+D +PLSRPK+N++RDFSDGVL+AE+I Y PKMV++HNY PA++ +K+ NW L RK +LNF+V D +++ PG VEL+L Sbjct: 5 VDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLVAEVIKFYFPKMVEMHNYVPANSLQQKLSNWGHLNRKVLKRLNFSVPDDVMRKIAQCAPGVVELVL 104 The following BLAST results are available for this feature:
BLAST of TCONS_00010900-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|