Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00010770-protein ID=TCONS_00010770-protein|Name=TCONS_00010770-protein|organism=Clytia hemisphaerica|type=polypeptide|length=102bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00010770-protein vs. Swiss-Prot (Human)
Match: P4HTM (Transmembrane prolyl 4-hydroxylase OS=Homo sapiens GN=P4HTM PE=1 SV=2) HSP 1 Score: 80.8777 bits (198), Expect = 2.619e-19 Identity = 39/92 (42.39%), Postives = 56/92 (60.87%), Query Frame = 0 Query: 9 DLFNLNEHCYDSNLVVKPQKRSAVAWYNHHVDANTGWLGEIDDWSLHGGCEVRKGEKWIANLWLTAPYAGEEMKLSMYSAEYMEMMRDRGED 100 DL + HC NL VKPQ+ +AV WYN+ D GW+G++DD+SLHGGC V +G KWIAN W+ + + +++ E + R+ G D Sbjct: 396 DLRDTRRHCDKGNLRVKPQQGTAVFWYNYLPDGQ-GWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPS--RARQALFQQEMARLAREGGTD 484 The following BLAST results are available for this feature:
BLAST of TCONS_00010770-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|