Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00010519-protein ID=TCONS_00010519-protein|Name=TCONS_00010519-protein|organism=Clytia hemisphaerica|type=polypeptide|length=107bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00010519-protein vs. Swiss-Prot (Human)
Match: CF183 (Putative uncharacterized protein C6orf183 OS=Homo sapiens GN=C6orf183 PE=5 SV=3) HSP 1 Score: 97.0561 bits (240), Expect = 2.974e-25 Identity = 45/107 (42.06%), Postives = 80/107 (74.77%), Query Frame = 0 Query: 1 MEGIYNCSSSEKVLNLEKELEKELKDLQNEIEAGGVIGKTEHQSFSSVPIPNDAKFFRKQRKIAVKNCLKVREAKPLLLQSELMKEEVDSCLKSEYTNESIPVLLHQ 107 M+ IY +S+E+V LEK+L +L +L++EIE G + T ++ +SS+ +P D +FR++R++A+K L+V E+KPL++Q++ ++ E++SCL+ EYT E++P+LL Q Sbjct: 1 MDEIYKITSTERVQLLEKKLAVQLTELKSEIEEQGALQGTANRVYSSIQMPKDIYYFRRERELALKKTLQVAESKPLVVQADAVQRELESCLRREYTPENLPLLLLQ 107 The following BLAST results are available for this feature:
BLAST of TCONS_00010519-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|