Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00009701-protein ID=TCONS_00009701-protein|Name=TCONS_00009701-protein|organism=Clytia hemisphaerica|type=polypeptide|length=462bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00009701-protein vs. Swiss-Prot (Human)
Match: RBM38 (RNA-binding protein 38 OS=Homo sapiens GN=RBM38 PE=1 SV=2) HSP 1 Score: 99.7525 bits (247), Expect = 7.339e-24 Identity = 45/82 (54.88%), Postives = 59/82 (71.95%), Query Frame = 0 Query: 63 RIFVGGLKFASEDIVLHEYFQQFGKIKEAVVIKDRKVGLSRGYGFVTMACDMSSLLAIMDKSPKLDGRRCNVNLAYIGQKKK 144 +IFVGGL + + D L +YF+ FG I+EAVVI DR+ G SRGYGFVTMA ++ A D +P +DGR+ NVNLAY+G K + Sbjct: 35 KIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPR 116 The following BLAST results are available for this feature:
BLAST of TCONS_00009701-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|