Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00009153-protein ID=TCONS_00009153-protein|Name=TCONS_00009153-protein|organism=Clytia hemisphaerica|type=polypeptide|length=211bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00009153-protein vs. Swiss-Prot (Human)
Match: PDIA3 (Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4) HSP 1 Score: 79.337 bits (194), Expect = 2.578e-17 Identity = 46/105 (43.81%), Postives = 59/105 (56.19%), Query Frame = 0 Query: 19 VNELTDNDFYSYAAKKQ---VLLVNFYAPWCSDCANLNPHFEGAATTLGPRG-ADLAKVDCFGAGKGMCEMYSVKSWPQLKSFHFGTYNGDYTGPQTTDGIANYI 119 V ELTD++F S + ++LV F+APWC C L P +E AAT L +G LAKVDC A C Y V +P LK F G G Y GP+T DGI +++ Sbjct: 27 VLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL--KGIVPLAKVDC-TANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHL 128 The following BLAST results are available for this feature:
BLAST of TCONS_00009153-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|