Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00008773-protein ID=TCONS_00008773-protein|Name=Hox9-14B homeodomain transcription factor protein|organism=Clytia hemisphaerica|type=polypeptide|length=452bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of Hox9-14B homeodomain transcription factor protein vs. Swiss-Prot (Human)
Match: HXB2 (Homeobox protein Hox-B2 OS=Homo sapiens GN=HOXB2 PE=1 SV=1) HSP 1 Score: 80.8777 bits (198), Expect = 1.251e-16 Identity = 42/96 (43.75%), Postives = 63/96 (65.62%), Query Frame = 0 Query: 235 PTETSTNNVTTNSPTP-TMINAAKDGLTLLDSNGH--RRKRTAYSRAQLAQLEAQFIESHFLTRERRCELSNCLGLSERQVKIWFQNRRMKAKRKS 327 P++++T+ S P + + + DGL L ++ G RR RTAY+ QL +LE +F + +L R RR E++ L L+ERQVK+WFQNRRMK KR++ Sbjct: 107 PSQSATSPSPAASAVPASGVGSPADGLGLPEAGGGGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQT 202 The following BLAST results are available for this feature:
BLAST of Hox9-14B homeodomain transcription factor protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|