Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00008631-protein ID=TCONS_00008631-protein|Name=TCONS_00008631-protein|organism=Clytia hemisphaerica|type=polypeptide|length=524bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00008631-protein vs. Swiss-Prot (Human)
Match: NOLC1 (Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2) HSP 1 Score: 104.375 bits (259), Expect = 1.418e-23 Identity = 44/75 (58.67%), Postives = 62/75 (82.67%), Query Frame = 0 Query: 448 STPFQRVKEDLIQIDEKLTDNSYEAKKGSTNGYGEKANDVLKKTKGKSFRQEKTKKKRGNYTGGTITTDVSSIYF 522 S+PF+RV+E+ I++D ++ DNS++AK+G+ +GE+AN VLK TKGKSFR EKTKKKRG+Y GG+I+ V+SI F Sbjct: 622 SSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKF 696 The following BLAST results are available for this feature:
BLAST of TCONS_00008631-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|