Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00008161-protein ID=TCONS_00008161-protein|Name=TCONS_00008161-protein|organism=Clytia hemisphaerica|type=polypeptide|length=100bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00008161-protein vs. Swiss-Prot (Human)
Match: ARSB (Arylsulfatase B OS=Homo sapiens GN=ARSB PE=1 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 3.468e-22 Identity = 39/70 (55.71%), Postives = 54/70 (77.14%), Query Frame = 0 Query: 20 GSKHPNIIMIVADDLGFNDVSFHGCPQIPTPNLDLLANKGIILNNYYVLPNCSPTRSALLTGRYPINTGM 89 S+ P+++ ++ADDLG+NDV FHG +I TP+LD LA G++L+NYY P C+P+RS LLTGRY I TG+ Sbjct: 41 ASRPPHLVFLLADDLGWNDVGFHG-SRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGL 109 The following BLAST results are available for this feature:
BLAST of TCONS_00008161-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|