Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00006950-protein ID=TCONS_00006950-protein|Name=TCONS_00006950-protein|organism=Clytia hemisphaerica|type=polypeptide|length=603bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00006950-protein vs. Swiss-Prot (Human)
Match: REQU (Zinc finger protein ubi-d4 OS=Homo sapiens GN=DPF2 PE=1 SV=2) HSP 1 Score: 115.161 bits (287), Expect = 1.139e-27 Identity = 48/104 (46.15%), Postives = 69/104 (66.35%), Query Frame = 0 Query: 199 CDYCQQNSKKNQ-FGQPEDLLICKDCSNKAHPSCLSYSQELVEQIRSDSSWQCIDCKACSICDGTGDPDTLLFCDACDKGYHMQCHTPKLEQTPSGKWACATCI 301 CD+C +SK N+ GQPE+L+ C DC HPSCL ++ ++ +++ WQCI+CK C+IC + + D LLFCD CD+GYHM C TP + + P G W+C C+ Sbjct: 273 CDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKT-YRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCL 375 The following BLAST results are available for this feature:
BLAST of TCONS_00006950-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|