Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00006252-protein ID=TCONS_00006252-protein|Name=TCONS_00006252-protein|organism=Clytia hemisphaerica|type=polypeptide|length=141bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00006252-protein vs. Swiss-Prot (Human)
Match: TADA1 (Transcriptional adapter 1 OS=Homo sapiens GN=TADA1 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 5.993e-18 Identity = 33/72 (45.83%), Postives = 54/72 (75.00%), Query Frame = 0 Query: 3 DVATARRKLMEALGEYSEKYWNNMKLWYKQKITKDDFDTQAFELLGPGKINYHNEFILSILAKCQSVAVSSP 74 ++ A++ L EALG+ ++YW N+KLW+KQKI+K++FD +A LL ++ HN+F+L+IL +CQ + VS+P Sbjct: 7 ELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQ-ILVSTP 77 The following BLAST results are available for this feature:
BLAST of TCONS_00006252-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|