Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00005010-protein ID=TCONS_00005010-protein|Name=TCONS_00005010-protein|organism=Clytia hemisphaerica|type=polypeptide|length=356bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00005010-protein vs. Swiss-Prot (Human)
Match: ELF2 (ETS-related transcription factor Elf-2 OS=Homo sapiens GN=ELF2 PE=1 SV=2) HSP 1 Score: 90.8929 bits (224), Expect = 5.951e-20 Identity = 39/91 (42.86%), Postives = 59/91 (64.84%), Query Frame = 0 Query: 36 LWSFIFNLLEDQHTPC---VRWTDREKLEFKIEDTEGLAQEWGQRKGKNTMTWAKFARAMRYYYGKDVLEKVERKRFTYKFIDSPKTRSVI 123 LW F+ +LL+D++T C ++WT REK FK+ D++ +++ WG+ K K M + RA+RYYY + +L KVE +R Y+F D PK VI Sbjct: 210 LWEFLLDLLQDKNT-CPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVI 299 The following BLAST results are available for this feature:
BLAST of TCONS_00005010-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|